KEGG   Rhizobium sp. IRBG74: BN877_I1303Help
Entry
BN877_I1303       CDS       T02867                                 

Gene name
gatB
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00970  Aminoacyl-tRNA biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN877_I1303 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rir03029]
    BN877_I1303 (gatB)
Enzymes [BR:rir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN877_I1303 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN877_I1303 (gatB)
Mitochondrial biogenesis [BR:rir03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN877_I1303 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CDI08211
UniProt: U4Q6K8
LinkDB All DBs
Position
1273395..1274900
Genome map
AA seq 501 aa AA seqDB search
MTLVDVRTPDPKRFIPGATGDWEIVIGMEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVD
AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQFKDPIVG
EGTITISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS
KPDMRSSDEAKAYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV
NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD
LLPLEFDDAFVEALKVDLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYEAVAAGR
DPKAAANWVINDLLGALNKSGKDIETTPVSPEQLGGIIDLIKAETISGKIAKDLFEIVWN
EGGNPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTLAGWFVGQVMKATG
GKANPQAVQALVKAKLGIEEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgtagacgtgcgcacccccgacccgaaacgcttcattcccggcgccaccggc
gattgggaaatcgtgatcggcatggaggtgcatgcgcaggttctctccaattccaagctg
ttctccggcgcctccaccaccttcggcaatgcgccgaattccaacgtgtcgctggtggat
gcggccatgcccggcatgctgcctgttatcaacgaggaatgcgtgaagcaggcggtgcgc
accggtctcggcctcaaggccaagatcaacaatcgctcgatcttcgaccgcaagaactac
ttctatcccgatttgccgcagggctatcagatttcgcagttcaaggatccgatcgtcggc
gagggcaccatcaccatttcgcttggtcccgaccgtcagggcaatttcgaggatatcgag
attggcatcgagcgcctgcatctggagcaggacgccggcaagtcgatgcacgaccagcac
ccgaccatgtccttcgtggacctgaaccgttcgggcgtggcgctgatggaaatcgtctcc
aagccggacatgcgttcgtcggatgaggcgaaggcctatctcaccaagctgcgctccatc
gtgcgttaccttggcacctgcgacggcaacatggacgaaggctccatgcgcgccgacgtc
aacgtctccgtgcgccgtccgggcgaaggcttcggcacgcgctgcgagatcaagaacgtc
aactccatccgcttcgtcggtcaggcgattgaatatgaggcgcgtcgccagatcgccatt
ctggaagatggcggcgtcatcgatcaggaaacccgcctgttcgatcccggcaagggcgag
acgcgctccatgcgctccaaggaagacgcgcatgactatcgctatttccccgatccggac
ctgctgccgctcgaattcgatgatgctttcgtcgaggcactgaaggtcgatctgccggaa
ctgcctgatgacaaaaaggctcgtttcgtggctgatctcggtctctcggtctacgacgcc
tcgattctggtctcagaaaaggcgattgccgattattacgaagccgtcgccgccggacgc
gatccaaaggctgccgccaactgggtcatcaacgacctgctcggcgcgctgaacaagtcc
ggcaaggacatcgagacgacgccggtgtcgcccgaacagctcggcggcatcatcgatctg
atcaaggccgagaccatctccggcaagatcgccaaggatctgtttgaaatcgtctggaac
gagggcggtaatccggccgagatcgttgaagcccgcggcatgaagcaggtgaccgacacc
ggcgccatcgaaaaggccgttgacgagatcatcgccgccaacccggatcaggtcgagaag
gtcaaggcgaagccaacgctcgccggctggttcgtcggtcaggtcatgaaggcgacgggc
ggcaaggccaacccgcaggcggtgcaggcgctggtgaaagcgaagctcggaatcgaggaa
gagtaa

DBGET integrated database retrieval system