KEGG   Rhizobium pusense IRBG74: BN877_I1670
Entry
BN877_I1670       CDS       T02867                                 

Definition
(GenBank) putative sugar hydrolase/Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00520  Amino sugar and nucleotide sugar metabolism
rir01100  Metabolic pathways
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN877_I1670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I1670
Enzymes [BR:rir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN877_I1670
SSDB
Motif
Pfam: Glyco_hydro_3
Other DBs
NCBI-ProteinID: CDI08570
UniProt: A0A1S9EMF3
LinkDB
Position
complement(1624551..1625567)
AA seq 338 aa
MTDCKAMILGCSGLSLTADEIALYRDEQPWGFILFGRNIGEPQQITDLVAAMRDAVGRAD
APVLIDQEGGRVQRIKPPILQAYPNARILGEIYERDRGAGLRAAWLMSRLHAFDLMKFGI
NVDCLPVLDVPVEGASNVIGNRAYGYTPTMVAEMGQAAADGLKAGGMLPVMKHMPGHGRG
MVDSHHELPVVDVPLDELDAHDFVPFRALNRELMAMSAHLVFNAVDRERPATTSPKVIEE
IIRGRIGFDGLLMSDDSSMNALKGTLGERAANIVAGGCDIVLHCNGVMGEMLEVVKEVPV
LSGRSLERVRAVEAGFPTADPSDEAELRAEFNAMWAVS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaccgattgcaaagctatgatcctcggatgcagcgggctttcgctgactgccgacgag
attgccctttaccgcgatgagcagccctggggtttcatcctgttcgggcgcaatattggc
gagccgcagcagatcaccgatctcgtcgccgccatgcgcgatgccgtcgggcgggcagat
gcgccggtgctgattgatcaggagggcggacgggttcagcgtatcaagccgccgatcctg
caggcttatccgaatgcccgcattctcggtgaaatctatgagcgcgaccggggtgccggt
ctgcgtgccgcctggctgatgtcgcgactgcacgcgtttgacctgatgaaattcggcatc
aacgtcgattgcctgccggtgctcgacgtgccggtggaaggcgccagcaatgtcatcggc
aaccgtgcctatggctatacgccgaccatggtggccgagatggggcaggcggcggccgac
gggctgaaggcgggtggcatgctgcctgtcatgaaacatatgccgggtcatggtcgcggc
atggtggattcgcatcatgaactgcctgtggtcgacgtgccgctcgatgagctggatgcg
catgacttcgtgcccttccgggcactgaaccgcgaattgatggcgatgagcgcgcatctg
gtgttcaacgccgtcgaccgcgaacggccggcgacgacttcaccgaaggtgatcgaggag
attattcgcgggcggatcggatttgacggcctgctgatgtccgacgacagttcgatgaac
gcgttgaagggcacgctcggtgaaagagctgcgaatattgttgctggcggctgcgatata
gtcttgcattgcaacggcgtgatgggtgaaatgctcgaggttgtgaaagaggttcccgtt
ctttccggccggtcgctggagcgggtgcgggcagttgaagcgggtttcccgactgcggac
ccatccgacgaagcggaactgagagccgaattcaacgccatgtgggccgtttcctga

DBGET integrated database retrieval system