KEGG   Rhizobium pusense IRBG74: BN877_I2725
Entry
BN877_I2725       CDS       T02867                                 

Definition
(GenBank) putative ATPase (yhcM) AFG1 family
  KO
K06916  cell division protein ZapE
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2725
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2725
SSDB
Motif
Pfam: AFG1_ATPase Bac_DnaA ATPase_2 AAA_22
Other DBs
NCBI-ProteinID: CDI09609
UniProt: U4PWW3
LinkDB
Position
complement(2631658..2632821)
AA seq 387 aa
MKPLPDYNHSVVEQLNALTAAGTLQADAAQLGVAAHLDRILADLKARKPAKKKSALGWMF
ARKAGPATTVKGLYVYGSVGRGKTMLMDMFYEMAPVSSKRRCHFHEFMADVHNRVHAHRQ
KLKNGETKQADPIPPVAAQLLAEAELLCFDEFTVTDIADAMILARLFSELFANGCTLVTT
SNVVPDNLYKDGLNRGLFLPFVELLKKHVEVVTLDSPTDYRMEKLESLPVYVTPLDGAAD
QAMDMAWRHMTGGHLVAPTEIPMKGRSILVPRASGRVARFAFSDLCEKPLGASDFLAIAN
RFDTVFIDHIPFLNADKRNETKRFIILIDALYDHSVRLFASAAAMPEDLLGKRKGTEGFE
FDRTASRLFEMRSADYLALHQEKRQKV
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaagccattgcctgattacaatcatagtgtcgttgaacagctcaacgcattgacggca
gctggcaccttgcaggccgatgccgcccagcttggtgtggcggcccatctcgacagaatt
ctcgccgatctgaaggcccgcaagcctgccaagaagaagagcgcgctcggctggatgttc
gcacgcaaggccggtccagcaacgacggtgaaagggctttatgtctatggcagtgtcggc
cgcggcaagacgatgctgatggacatgttttacgaaatggcgcccgtttcttccaagcgg
cgttgccattttcatgaattcatggcggatgtgcataatcgtgtgcatgcgcaccggcag
aagctgaagaatggcgagaccaaacaggccgatccgattccgcctgtcgccgcccagctt
ctggcggaggccgaactcctgtgtttcgatgaatttaccgtgacggatattgctgatgcg
atgatcctcgcgcggctattcagcgagctcttcgccaatggctgcacattggtgacgacc
tccaatgtcgttccggacaatctctacaaggatggtctcaatcgcggcctgttcctgccc
tttgtcgagctgctgaagaagcatgtggaggtggtgacgctggacagtcccaccgattat
cggatggagaagctggaaagcctgccggtctatgtgacgccgcttgatggcgcggccgat
caggcgatggatatggcgtggcggcacatgaccggcgggcaccttgttgcaccaaccgag
atacccatgaagggtcgttccatcctggtgccgcgcgccagcggccgtgtggcgcgtttt
gccttttccgacctttgcgagaagccgctcggggcttccgacttccttgccatcgccaat
cgtttcgacacggtcttcatcgaccacattccatttttgaacgcggacaaacggaacgaa
accaagcgtttcatcatcctcatcgacgcgctttatgatcacagcgtcaggctgttcgcg
tcggcagccgctatgccggaagacctgctcggcaaacgcaagggaacggaaggtttcgag
ttcgatcgcaccgcctcgcgtctgtttgaaatgcgtagcgccgattatctggcgcttcat
caagaaaaacggcagaaagtttga

DBGET integrated database retrieval system