KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120704
Entry
pRL120704         CDS       T00402                                 

Definition
(GenBank) putative hydratase/decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00362  Benzoate degradation
rle00621  Dioxin degradation
rle00622  Xylene degradation
rle01100  Metabolic pathways
rle01120  Microbial metabolism in diverse environments
rle01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    pRL120704
   00622 Xylene degradation
    pRL120704
   00621 Dioxin degradation
    pRL120704
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     pRL120704
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: CAK12413
GeneDB: pRL120704
RhizoBase: pRL120704
UniProt: Q1M3B3
LinkDB
Position
pRL12:complement(762910..763680)
AA seq 256 aa
MYFGLKDTTAEILAKSRLHDALCDLPLDLIDSEREAYDIQALAQDALGFERKGYAIVGSS
ESARRALGLTKPIYSAIPALALASATAVFRLPPGVIGAQCEFTFTMRRAFPDADEPISLE
TVADAVAACRPAIGIIGRRTGRAFAGDNSAIADFGLHVATVRGSQTAEVDLSALGKLDVN
VFLFREVGISGNASSVMGHPLNAVAWLAGALSSRGKQLQTGDVVATGACTRVLRVHAGQH
VAADFGPLGQVECIFE
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtacttcggactcaaagacaccacggccgaaatccttgccaaaagtcgtctgcatgat
gcgctttgcgacctgccgctcgatctgatcgactccgagcgggaggcctatgacatccag
gccctagcccaggacgctctcggatttgagcgcaagggatacgctatcgtcggatccagc
gagtccgcccgccgtgcgctggggctcaccaagccgatttattcggcgatcccggctctc
gcgcttgcatccgcaacggcggtgtttcgattgccgccgggcgtcatcggcgcccagtgc
gaatttacattcacgatgcggcgagcatttcctgatgctgacgagcccatttcgctggaa
accgttgccgatgctgttgctgcatgccggccggcaatcggcatcatcggacgtcgcacg
ggtcgggcgttcgccggcgacaattccgcgatcgcagattttggtctgcacgtcgcgacc
gttcggggcagtcagacggctgaggtcgatctctccgcgcttgggaagctcgacgtcaat
gtcttcctgttcagggaggtcgggatttcgggaaatgcatcatctgttatggggcatccc
ctgaacgctgtggcctggctggctggcgccctctcctctcgtggcaagcaacttcagacc
ggcgatgtcgtcgcgacgggcgcctgcacgagggtcctccgcgttcatgcgggacagcat
gttgccgccgatttcgggccgctgggccaagtcgaatgcattttcgagtag

DBGET integrated database retrieval system