KEGG   Rhopalosiphum maidis (corn leaf aphid): 113555859
Entry
113555859         CDS       T06065                                 

Definition
(RefSeq) uncharacterized protein LOC113555859 isoform X1
  KO
K20017  Bcl-2 family protein
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04214  Apoptosis - fly
rmd04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    113555859
   04215 Apoptosis - multiple species
    113555859
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113555859
NCBI-ProteinID: XP_026816230
LinkDB
Position
3
AA seq 436 aa
MVKQCLKKILKKFNMPGQLSVWPVCLFSVNKPEIGRIKSSHTSSKRCNEARRMSEGGLVM
SSCAAANFNNNNTTNNNNSSSSHSGVGRTTTSAVPRRKFSFPAVLQSHSLQSELGGVDFG
GGPSLTVATARRRFSNVSDVVSRKLSHTIGWRTAVPTEQIARHGKALCVQYVRWKLKRAG
AYTKKCAGALRTASAAASPAASVDGSGGAAGGSGGGYFIPPLQAMAAAGGADHTDGVRRD
VFPAVLRVGLQLERLDPKLYATGAVAAETAAATAASTAGGAGDPSATAPTADSAVSPQRL
FQRHHRPSYRRNVATASMVLVSVSRELFRAGAQVTWAKVVSLMCVAAGLAVDCARRGRAD
QLPDLIEAVGEVIEDDLAAWIHYNGGWMGLQSYCKPVVINVENPVSTQILYLVSLLIVVI
FFLLLLRWFDFISVFR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggtcaaacagtgtttgaaaaaaattttgaaaaaatttaatatgcccggacaactctct
gtgtggcccgtatgccttttcagtgtcaataaaccagaaattggacgcatcaagagttct
catacttcctcaaaaaggtgtaatgaagcgcggcgtatgtccgaaggtggtctcgtcatg
tcttcatgcgcggctgccaacttcaacaacaacaacacgacaaacaacaacaacagcagc
agcagccacagcggcgtcggcaggacgacgacgtccgccgtgcccaggcgcaagttcagc
ttcccggcggtgttgcagtcgcacagcctgcaatccgaactgggcggcgtcgacttcggc
ggcgggccgtcgctcaccgtggccacggcccgccggcggttcagcaacgtcagcgacgtc
gtgtcccggaaactgtcgcacaccatcggctggcggacggccgtgccgacggaacagatc
gcgcgacacggcaaggcgctgtgcgtgcagtacgtccggtggaagctgaagcgggccggc
gcgtacacgaaaaagtgcgccggagcgttgcgcacggccagcgcggccgccagcccggcg
gcttcggtggacggcagtggcggcgccgccggcggaagtggcggcggctacttcataccg
ccgctacaggctatggcggcggccgggggggccgaccacaccgacggcgtgcgccgcgac
gtgttccccgccgtgctccgggtcggactccagttggagcggctcgacccgaaactgtac
gcgaccggagcggtagccgccgagaccgcggccgccaccgccgcgtccacggccggtggt
gcgggcgacccgtcggcgaccgcgccgaccgccgactcggccgtgtcgcctcagcgcctg
ttccagcggcaccaccggccatcgtacaggagaaacgtggccaccgcttcgatggtcctg
gtgtccgtgtcccgggaactgttccgggccggcgcccaggtcacgtgggccaaagtcgtg
tcgctcatgtgcgtggccgccgggctggcggtcgactgcgcgcgccgcggccgtgccgat
caactgcccgacctgatcgaagccgtcggcgaagtgatcgaggacgatcttgccgcttgg
atacactacaacggcggatggatggggctccagtcgtactgcaaaccagtggtcatcaac
gtcgaaaatcctgtgtccactcaaatcctgtatctagtgtcattgctcatagttgtcata
ttttttttgttgttgttgaggtggttcgacttcatatctgttttccgatga

DBGET integrated database retrieval system