KEGG   Roseovarius mucosus: ROSMUCSMR3_03239
Entry
ROSMUCSMR3_03239  CDS       T04779                                 

Gene name
phoR
Definition
(GenBank) alkaline phosphatase synthesis sensor protein PhoR
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
rmm  Roseovarius mucosus
Pathway
rmm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROSMUCSMR3_03239 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rmm01001]
    ROSMUCSMR3_03239 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rmm02022]
    ROSMUCSMR3_03239 (phoR)
Enzymes [BR:rmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ROSMUCSMR3_03239 (phoR)
Protein kinases [BR:rmm01001]
 Histidine kinases
  OmpR family
   ROSMUCSMR3_03239 (phoR)
Two-component system [BR:rmm02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   ROSMUCSMR3_03239 (phoR)
SSDB
Motif
Pfam: Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Other DBs
NCBI-ProteinID: ARE84702
UniProt: A0A1V0RSV9
LinkDB
Position
3352424..3354136
AA seq 570 aa
MALVERIGVRSVEPRKDNDLVLGDDFVAPDRLDEGELNARRAKRGWFSFRDSSLTRKIIT
FNLIALNVLVVGILYLNSSRDNLAMQRANSLMVQTALIADVVEARLPVGAPVSFATGDGV
DMATTLDNLDIQTGTEVFLFDRTGMLVGRKQGDTMGQDRTATLPSTPMTDFLSRVWDRIS
SPFSGVDQVSASRVVEDVARDMVDLAVGGGVEVRTAETAQGVVLTVAAPVMQGNTPVAVV
ALANASGEIDKLARVERERVLQMFLIATLVSVGLSLILASTISNPLADLAAAAEIGRDRN
KGKGAKGRIRIPDLTARPDEIGRLSGALRGMVSALYHRIDSNEQFAADVAHEIKNPLASL
RSAVGTMRIAKRDDQRERLLEVIEHDVRRLDRLVSDISNASRLDSELVKEEQESFDLLKM
LQNLGTYLGEEAQKNGIEFIMDFPPQPIVTTGLEGRLAQVFVNLITNAISFCEEGDAIRV
WARRRANRVLVVVEDTGPGIPEQALEKVFQRFYSERPEGDFGNNSGLGLAISKQIVEAHD
GVIWAENIRPTHADATSDPLGARFVVGLPV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggctctggtcgagcggataggggtgcggagcgtggagccgcgaaaggataacgacctt
gtccttggcgatgattttgtcgcaccggatcgtctggacgaaggagagctgaatgcccgc
cgcgccaaacgcggctggttcagctttcgtgactcctcgctgacgcgcaagattatcacc
ttcaacctgattgcgctcaacgtgctggttgtgggtatcctctatctcaattcgtcacgc
gacaatctcgcgatgcagcgcgccaacagcctgatggtgcagacagccctgatcgcggat
gtggtcgaggcgcgtctgcccgtcggtgcgccggtcagttttgcaaccggcgatggggtg
gatatggccaccacgctggacaatctggatattcagaccggaacagaggtgtttttgttt
gatcgcaccggcatgttggtggggcgcaagcagggcgatacgatggggcaggaccgcact
gcgaccctgccatcaacgccaatgacggattttctcagccgggtgtgggatcggatttca
agcccgttttctggcgtggatcaggtctctgccagccgtgtggtcgaggatgtggcccgc
gacatggtcgatctggcagtgggcggcggcgtagaagtgcgcaccgccgagaccgcgcag
ggcgttgttctgacggtggccgccccggtgatgcaaggcaatacacctgtcgcggtggtg
gcgttggccaatgccagcggcgagattgacaagctggcaagggtagagcgcgagcgcgtg
cttcagatgttcctgattgccactttggtatcggtgggtctcagcctcattcttgcctcg
accatttcgaaccccttggccgatctggcggcggctgcggaaatcgggcgcgaccgtaac
aagggcaaaggggccaagggacgtatccgtatccccgacctgaccgcgcgccccgatgaa
atcgggcgtcttagcggtgcgttgcgtggcatggtctcggcgctttaccaccggatcgac
agcaacgagcaattcgccgctgacgtggcccatgagatcaagaaccctctcgccagcctg
cgctctgccgtgggcaccatgcgcattgccaagcgcgacgatcagcgcgagcgtctgttg
gaggtgatcgaacatgatgtgcgccgtctggaccgtctggtgagcgatatttccaatgcc
tcgcggcttgacagcgaattggtcaaggaagaacaagaatcctttgatctgctcaagatg
ttgcagaacctcgggacatatctgggcgaagaggcgcagaagaacgggatcgaattcatc
atggatttcccgcctcagcccatcgtcaccaccgggcttgaggggcgattggcacaggtg
tttgtcaatctcatcaccaatgccatcagtttctgcgaagagggtgacgcaatccgcgtt
tgggcgcgccgccgtgccaaccgcgtgctggtggtggtcgaagataccggccctggtatc
cctgaacaggcgctggaaaaggtcttccaacgcttctactccgagcggcccgagggggat
ttcggcaataattctggccttggtcttgcgatctccaaacagatcgtcgaggcgcatgat
ggtgtgatctgggccgaaaacattcgtcccacccatgccgatgccacctcagatcccttg
ggcgcgcgctttgtcgtgggtctgccggtctga

DBGET integrated database retrieval system