KEGG   Rhodothermus marinus DSM 4252: Rmar_1396Help
Entry
Rmar_1396         CDS       T01119                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00010  Glycolysis / Gluconeogenesis
rmr00020  Citrate cycle (TCA cycle)
rmr00620  Pyruvate metabolism
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
Module
rmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_1396
   00020 Citrate cycle (TCA cycle)
    Rmar_1396
   00620 Pyruvate metabolism
    Rmar_1396
Enzymes [BR:rmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rmar_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23 HlyD_3 QRPTase_N DUF2118 AKAP7_RIRII_bdg
Motif
Other DBs
NCBI-ProteinID: ACY48285
UniProt: D0MIH7
LinkDB All DBs
Position
complement(1629388..1630713)
Genome map
AA seq 441 aa AA seqDB search
MAIPIEMPKMSDTMEEGVLVAWLVEEGQRVSAGDVIAQVETDKATMDLEVYDDGVLLKKV
VKEGESVPIGGLIAVLGDEGEDISEILERYSGQKEAPAQAEPAPEAAPAEAAPQAEQPAR
AGDGAPAPAVTAGDGAEARIKASPLARKLAREYGLDLRTIQGTGPEGRIVRRDIEAALAR
QRPSVEVAAPAPEAAPAPAPAPTPTPAPELPYESVPITSMRRTIARRLAQSKFTAPHFYL
TVDVDVEKAIAFRQQLNELAEAQERPKISFNDLITKACALALRRHPEINASYLEQEGEIR
RWKEIHIGIAVALEDGLVTPVIRNADQKGLGQIAEETRALAEKARQRKLQPQEMEGATFT
TSNLGMYGIEEFTAIINPPNACILAIGAIRDVPVVKNGMIVPGKRMRLTLSCDHRIVDGA
TGARFLKTVQQYLEEPLNLLL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcccattgaaatgcccaagatgagcgacacgatggaggagggggtgctggtg
gcgtggctggtggaagaagggcagcgcgtgtcggccggggacgtgatcgctcaggtggaa
acggataaagccacgatggacctcgaagtgtacgacgacggggtcctgctgaagaaagtg
gtcaaagaaggcgaatcggtccccatcggtggcctgatcgccgtgctgggggatgaaggc
gaagacatttcggagattctggagcgctacagcggccagaaagaggcgcccgcgcaggcg
gagccggcgccggaggctgcaccggccgaagcggcaccgcaggccgagcagccagcccgc
gcgggggatggcgctccggctcccgcggtgacggccggcgacggcgctgaggcgcgcatc
aaggcctcgcccctggcgcgtaagctggccagagagtacgggctggacctgcgcaccatt
cagggcacgggacccgaggggcgtatcgtgcgccgcgacatcgaggcggcgctggcccgt
cagcgtccgtccgtcgaagtggccgcaccggcgcccgaagccgcgcctgcaccggccccg
gccccgacgcccacgccggcgcccgagctgccctacgagtcggtgcccatcacgtcgatg
cgccgcacgatcgcgcggcggctggcgcagagcaaattcacggcgccgcatttctatctg
accgtcgacgtggacgtcgagaaagccatcgccttccgccagcagctcaacgagctggcc
gaagcgcaggaacggcccaagatctccttcaacgacctgatcaccaaggcctgcgcgctg
gcgctgcgccggcatcctgagatcaacgcctcctacctggagcaggaaggcgaaattcgc
cggtggaaggagattcatatcggaatcgccgtggcgctggaggacgggctggtgacgccg
gtcatccgcaacgccgaccagaaagggctgggccagatcgccgaggagacgcgcgcgctg
gccgagaaagcccgccagcgcaaactgcagccccaggaaatggaaggggcgaccttcacc
acgagcaacctggggatgtacggcatcgaggaattcacggccatcatcaatccaccgaac
gcctgcatcctggccatcggcgccatccgcgacgtgcccgtggtgaaaaacggcatgatc
gtgcccggcaagcggatgcggctgaccctctcgtgcgatcaccggatcgtcgatggtgcc
acgggcgcccgcttcctcaagaccgtccagcagtacctggaagagccgctgaatctgctg
ctgtaa

DBGET integrated database retrieval system