KEGG   Rothia mucilaginosa: RMDY18_00220
Entry
RMDY18_00220      CDS       T01144                                 

Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00052  Galactose metabolism
rmu00520  Amino sugar and nucleotide sugar metabolism
rmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    RMDY18_00220
   00520 Amino sugar and nucleotide sugar metabolism
    RMDY18_00220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmu04147]
    RMDY18_00220
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     RMDY18_00220
Exosome [BR:rmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RMDY18_00220
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-ProteinID: BAI63854
UniProt: D2NQC8
LinkDB
Position
complement(22175..23572)
AA seq 465 aa
MSMTATAQWAALPDHSAEIARVREEFITAYGYEPDGVWSAPGRLNLLGEYIDFLGGSCLP
MPLPYRTYIAGALRRDGVLRASSLQMPGDERTVVIRDIQPGHLKGWFTYVAGVAWAMNQE
GGRDIMLPDEFGADLLINSRVPVGGGLSSSAALECSTALALLELSCPVREECPEADATPA
DNDALRARLAQVCITAENKVAGAHTGGLDQTASLRSYPEQALVVDFRDFSIEPVAVDIAQ
HGLSFLVIDTNTPHELTDGGFAARRAASEACADALGLRFLRDALPEDLSCAGMDARAAKA
WRADLVDSSVNRALDALEDAGRPCSFPRGWVRHAFHDMTLVGRASYLLQHADELGFAAFE
EAGRIFTESFVSMRDELRVSRPEIDDAVQVCLDQGALGARIVGGGFGGAVMALIPTSQLE
AAADAVATTYAVRGYAAPRFLPMVAGFAASHDWAAGADPTDIPVL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtcgatgaccgctaccgcccagtgggcggctcttccggaccatagcgcggagattgcg
cgtgtgcgtgaggagtttattactgcgtatggttatgagcctgatggtgtgtggtctgcg
cctgggcgcctgaatcttttgggcgagtacattgattttttgggtggctcgtgtctgccg
atgccgttgccgtatcgcacgtatattgcgggtgcgttgcgtcgtgatggtgtgttgcgt
gcttcgtcgttgcagatgcccggcgatgagcgcacggttgtgattcgcgatattcagccg
gggcatttgaagggctggttcacctatgtggcgggtgttgcgtgggcgatgaatcaggag
ggcggcagggatattatgctgcccgatgagtttggcgctgacctgctgattaattctcgt
gttccggtgggtggcggtttgtcgtcttcggcggcgttggagtgttctacggcgttggcg
ctgttggagctctcgtgtccggtgcgtgaggagtgcccggaagcggatgccaccccggct
gataatgatgcgttgcgtgcgcgtctggctcaggtgtgtattacggctgagaataaggtg
gctggcgcgcatacgggtggcctggatcagacggcgtcgttgcgttcgtatccggagcag
gctctggtggttgatttccgtgatttttcgattgagccggttgcggtggatattgctcag
catgggctgagttttttggtgattgatacgaatactccgcatgagctgacggatggcggt
tttgcggctcgtcgtgcggcgtctgaggcgtgtgctgacgctttgggtctgcgttttttg
cgtgatgccctaccggaggatttgtcgtgtgcgggtatggatgcgcgtgctgcaaaggcg
tggcgtgcggatttggtggattcttcggtgaatcgtgccctggatgcgctggaggacgcg
ggtcgtccgtgttcgttcccgcgtggttgggtgcgtcatgcgttccacgatatgactctg
gtgggtcgtgcgagctatttgctgcagcacgctgatgagcttggtttcgcggcatttgag
gaggctggccgcattttcacggagtcgtttgtgtcgatgcgtgatgagttacgtgtttct
cgcccggagattgatgatgcggtgcaggtgtgcctggatcagggtgcgctgggtgctcgt
attgtgggtggcggttttggtggcgcggtgatggcgctgattcccacttctcagcttgag
gctgctgcggatgcggtggcaaccacctatgctgtgcgcggctatgcggcgcctcgtttt
ttgccgatggttgctggttttgcggcgtctcatgattgggctgcgggcgctgatcctacg
gatattccggtgttgtag

DBGET integrated database retrieval system