KEGG   Rothia mucilaginosa: RMDY18_04520
Entry
RMDY18_04520      CDS       T01144                                 

Definition
(GenBank) nitrate reductase beta subunit
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00910  Nitrogen metabolism
rmu01100  Metabolic pathways
rmu01120  Microbial metabolism in diverse environments
rmu02020  Two-component system
Module
rmu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RMDY18_04520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RMDY18_04520
Enzymes [BR:rmu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     RMDY18_04520
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     RMDY18_04520
SSDB
Motif
Pfam: Fer4_11 Nitr_red_bet_C Fer4_10 Fer4_7 Fer4_9 Fer4_6 Fer4 Fer4_4 Fer4_15 Fer4_2 Fer4_8 Fer4_21 Fer4_13
Other DBs
NCBI-ProteinID: BAI64284
UniProt: D2NRK8
LinkDB
Position
473277..474890
AA seq 537 aa
MRVMAQVAMVMALDKCIGCHTCSVTCKQAWTNRAGTEYVWFNNVETRPGQGYPRRYEDQE
KWKGGWVLNKRGRLELKSGNRFQKLFTIFASPIQPELNDYYEPWTYDYQNLTSAPLGDDF
PAAKPISLITGEDTKVEWGMNWDDNLAGATEYGHLDPLVEKVRKKAEDKIKFEFEQTFMF
YLPRICEHCLNPSCMASCPSGAIYKRAEDGIVLVDQDRCRGWRQCITGCPYKKVYFNHKT
GKAEKCTFCYPRIEAGIPTVCAETCVGRMRYIGIFLYDADRVTEAASVEDEKDLYEAQLS
LMLDPSDPAVIEQARKNDIPDAWITAAQKSPVYKLAKEWKVALPLHPEYRTMPMVWYVPP
LSPIVDLLKEQGHDAENSNNLFGAIESLRIPVEYLAELFTAGDTEVVTNVLRRLAAMRSY
MRDINLGGEGNEEIAQAVGMTGQQVYEMYRLMAIAKYNERYVIPKAHMEDAHNLEEMGCS
LSVDGGPGMYGDAFNDMEGRPTPVSTGVYEANNKVSLFSWDGSSRPDGLFPNTTGKK
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcgcgttatggcacaagttgctatggtgatggcgctcgataagtgcatcggctgccac
acctgctccgtgacctgtaagcaggcatggacgaaccgagccggtaccgagtacgtctgg
ttcaacaacgttgagactcgtcccggtcagggttacccccgccgttacgaggatcaggag
aagtggaagggcggctgggtgctgaacaagcgcggtcgtctggagctcaagagcggtaac
cgcttccagaagctcttcacgattttcgcttccccgattcagcccgagctgaacgactac
tacgagccctggacctacgattaccagaacctgaccagtgctcctctgggtgatgacttc
ccggctgctaagccgatctccctcatcaccggtgaggacaccaaggttgagtggggtatg
aactgggacgacaacctggctggtgcgaccgagtacggtcacctggacccgctggtggag
aaggttcgtaagaaggctgaggacaagattaagttcgagttcgagcagaccttcatgttc
tacctgcctcgtatttgtgagcactgcttgaacccctcctgcatggcttcctgcccctcc
ggcgctatctacaagcgcgctgaggacggtatcgtgctggttgaccaggaccgttgccgt
ggttggcgtcagtgcatcaccggctgcccctacaagaaggtgtacttcaaccacaagacg
ggtaaggctgagaagtgtaccttctgctacccccgtattgaggctggtattccgaccgtg
tgtgctgagacctgtgttggtcgtatgcgctacatcggtatcttcctctacgatgcagac
cgcgtgaccgaggctgcttcggttgaggatgagaaggacctctacgaggctcagctgtcg
ctgatgcttgatccttcggatccggctgtgattgagcaggctcgtaagaacgacatcccc
gatgcgtggattactgcagctcagaagtcgcccgtgtacaagctggcgaaggagtggaag
gtggctctgcccctgcaccccgagtaccgcaccatgcccatggtttggtacgtgccgccg
ctgtctccgattgttgacctgctcaaggagcagggccacgatgcagagaacagcaacaac
ctgttcggtgctattgagtctctccgtattccggttgagtacttggctgagctgttcacc
gcaggcgacactgaggttgttactaacgttctgcgccgtctggctgcgatgcgttcgtac
atgcgtgatatcaacctcggtggcgaaggcaacgaagagattgctcaggctgttggtatg
accggtcagcaggtgtacgagatgtaccgcctgatggctatcgctaagtacaacgagcgt
tacgtcatcccgaaggctcacatggaggacgcccacaaccttgaggaaatgggctgctcc
ctgagcgtggatggcggacccggcatgtacggcgatgcgttcaacgatatggagggtcgc
ccgacccccgtgtccaccggtgtctacgaggctaacaacaaggtcagcttgttcagctgg
gacggttcttcccgccctgacggcctcttcccgaacaccaccggaaagaagtaa

DBGET integrated database retrieval system