KEGG   Rothia mucilaginosa: RMDY18_06620
Entry
RMDY18_06620      CDS       T01144                                 

Definition
(GenBank) chorismate mutase
  KO
K04092  chorismate mutase [EC:5.4.99.5]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RMDY18_06620
Enzymes [BR:rmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     RMDY18_06620
SSDB
Motif
Pfam: CM_2
Other DBs
NCBI-ProteinID: BAI64494
UniProt: D2NS68
LinkDB
Position
704904..705356
AA seq 150 aa
MPQQPARAQRTEDHNRTEERPMTAEHTSCEFDPHATSMGDEVAPEVYEELFAMRRSIDNF
DAALVHILAERFQATKRVGVLKAEHNLPAGDPGREEAQIARLRAMAKESSLDPEFAEKFL
NFIISEVIRHHVRIANEHADQDEETEKSES
NT seq 453 nt   +upstreamnt  +downstreamnt
ttgccgcaacagcctgctcgagcgcaacgcacagaagaccacaaccggactgaggagaga
ccgatgactgccgaacacacttcctgcgaatttgacccccatgccacctccatgggcgat
gaagtcgcgccggaggtttacgaggagctcttcgccatgcgccgctccatcgacaacttc
gacgcagcgttggtgcacatcctcgcggagcgttttcaggcaaccaagcgcgtgggcgtc
ctgaaggctgagcacaacctgcccgccggcgaccccggccgtgaagaggcacagattgct
cgcctgcgtgccatggcgaaggaatccagcctggacccggaattcgcggagaagttcctg
aacttcatcatctctgaggtgattcgccaccacgtgcgcatcgcgaacgagcacgctgac
caggacgaagagactgaaaagtctgaaagctaa

DBGET integrated database retrieval system