KEGG   Rothia mucilaginosa: RMDY18_11700
Entry
RMDY18_11700      CDS       T01144                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00061  Fatty acid biosynthesis
rmu00780  Biotin metabolism
rmu01100  Metabolic pathways
rmu01212  Fatty acid metabolism
rmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RMDY18_11700
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RMDY18_11700
Enzymes [BR:rmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     RMDY18_11700
Lipid biosynthesis proteins [BR:rmu01004]
 Fatty acid synthase
  Component type
   RMDY18_11700
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Other DBs
NCBI-ProteinID: BAI65002
UniProt: D2NTM6
LinkDB
Position
complement(1301880..1303247)
AA seq 455 aa
MKTPTVNPGPYRFLSTHHRINHQIDHRRESATMSRKVLVTGLGATTPIGGDVPTTWENAT
KGVSGVSTLDHPWVKEYDLPVYIAGQLAVPALESGRLTKVEAKRLDPSGQLALIAAREAW
EDAGFSGPDAESAEEVDPERTGVAFGTGIGGVWTLLDAWDTLREKGPRRVLPMTVPMLMP
NGNAAAVSMNLKARAAAQTVVSACASSTEAMQLGAEMIRSGKADVVIVGGAEAAIHPLPM
AAFAKMQALSSRNDEPEKASRPYDVDRDGFVMGEGAAALILESEEHAKARGARVYAELAG
TGVSADSYHITAPDPAALGATRALREALEDGNIDPKTVVHINAHATSTPAGDLPEATAMH
ETFGEHTKNIAVSATKSMTGHLLGGAGALEAVLTVLALHHRTAPCTINLDNKDPQIDLDV
VTEARELPAGEIVALSNSFGFGGHNAVVAFRSVEG
NT seq 1368 nt   +upstreamnt  +downstreamnt
gtgaaaacgcccactgtaaaccccgggccctacaggtttttatccacacaccaccggata
aaccaccaaatcgaccaccgaagagaaagtgccacaatgtctcgaaaagtgctggtgacc
ggcctcggcgcgaccacccccattggcggcgacgtccccaccacctgggaaaacgcaacc
aagggcgtatctggtgtatccaccctcgaccacccctgggtcaaggaatacgacctgccc
gtatacattgcaggccagctcgcagtgcccgccctcgaatccggccgcctcaccaaggta
gaagcaaagcgcctggatccctcgggccagctcgccctcatcgccgcacgcgaagcatgg
gaagacgcaggattctccggccccgacgccgaatccgcagaagaagtcgaccccgaacgc
accggcgtagccttcggcaccggtatcggcggcgtgtggaccctcctcgacgcatgggac
accctccgtgaaaagggcccccgccgcgtcctccccatgaccgttcccatgctcatgccc
aacggcaacgcagcagccgtctccatgaacctcaaggcacgcgccgcagcacagaccgtc
gtctccgcatgcgcatcctccaccgaagccatgcagctcggtgctgaaatgatccgcagt
ggcaaggcggacgtcgtcatcgtcggcggtgccgaagcggcaatccacccgcttcccatg
gcagcattcgccaagatgcaggcactctcctcccgcaacgacgaacccgaaaaggcatcc
cgcccctacgacgtcgaccgcgacggcttcgtcatgggtgaaggcgcagcagcgctcatc
ctcgaatccgaagagcacgccaaggcacgcggcgcacgcgtctacgcggaactggcaggc
accggcgtatccgccgactcctaccacatcaccgcaccggaccccgcagcactcggcgca
acccgcgcactgcgcgaagccctcgaagacggcaacatcgacccgaagaccgtcgtgcac
atcaacgcgcacgccactagcacccccgccggtgacttgcccgaagcaaccgcaatgcac
gaaaccttcggcgagcacaccaagaacattgccgtctccgcaaccaagtccatgaccggc
cacctgctcggcggcgcgggtgccctcgaggcagtgctgaccgtactggcgctgcaccac
cgcaccgcaccctgcaccatcaacctggacaacaaggacccccagattgacctggacgtg
gtgaccgaggcgcgcgagctgcccgctggtgagattgtggcactgtcgaactccttcggt
ttcggcggtcacaacgcggttgtagcattccgctccgtagagggctaa

DBGET integrated database retrieval system