KEGG   Rattus norvegicus (rat): 24651Help
Entry
24651             CDS       T01003                                 

Gene name
Pklr, PK1, PKL, Pklg
Definition
(RefSeq) pyruvate kinase, liver and RBC
  KO
K12406  pyruvate kinase isozymes R/L [EC:2.7.1.40]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00230  Purine metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04950  Maturity onset diabetes of the young
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24651 (Pklr)
   00620 Pyruvate metabolism
    24651 (Pklr)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24651 (Pklr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24651 (Pklr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24651 (Pklr)
   04950 Maturity onset diabetes of the young
    24651 (Pklr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24651 (Pklr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24651 (Pklr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     24651 (Pklr)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24651 (Pklr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C IMPDH HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 24651
NCBI-ProteinID: NP_036756
RGD: 3336
Ensembl: ENSRNOG00000020420
UniProt: P12928 B1WBN9
LinkDB All DBs
Position
2q34
AA seq 543 aa AA seqDB search
MEGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSQPVAARSTSII
ATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREATESFATSPLSYRPV
AIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFQTRGDAKTVWVDYHNITRVV
AVGGRIYIDDGLISLVVQKIGPEGLVTEVEHGGILGSRKGVNLPNTEVDLPGLSEQDLLD
LRFGVQHNVDIIFASFVRKASDVLAVRDALGPEGQNIKIISKIENHEGVKKFDEILEVSD
GIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDV
ANAVLDGADCIMLSGETAKGSFPVEAVMMQHAIAREAEAAVYHRQLFEELRRAAPLSRDP
TEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSQYRPRAAVIAVTRSAQAARQVHLSRG
VFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVL
SVS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggaagggccagcgggataccttcgacgtgcgagtgtggctcaactgacccaggagctg
ggcactgccttcttccagcagcagcaactgcccgcagctatggcggacaccttcctggaa
cacctctgccttctggatatcgactcacagcctgtggctgctcgtagcaccagcatcatt
gccaccattgggccagcatcccgctctgtggaccgcctcaaggagatgatcaaagcaggg
atgaacattgcacgactcaacttctcccatggctcccatgagtaccatgcagaatccatc
gccaacatccgggaggcaactgagagttttgcaacctccccactcagctacagacctgtg
gccatcgccctggacaccaagggacctgagatacgaaccggagtcttgcaggggggtccg
gagtcggaggtggaaattgtgaagggctcacaggtgctggtgacggtggacccgaagttc
cagacaaggggcgatgcaaagacagtgtgggtggactaccacaatatcacccgggtcgtt
gcagtggggggccgcatctacattgacgacgggctcatctccttagtggtacagaaaatc
ggcccagagggactggtgacagaagtggagcacggtggtatcttgggcagcaggaagggt
gtgaacttgccaaacactgaggtggacctgcccgggctgtctgagcaagaccttttggat
ctgcgcttcggggtgcagcataatgtggacatcatctttgcctcctttgtgcggaaagcc
agtgacgtgttagcagtccgggatgccctggggccagaaggacagaacatcaaaattatc
agcaaaatcgagaaccatgaaggcgtgaagaagtttgatgaaattctagaagtgagcgat
ggcatcatggtggcacggggtgacctgggcattgagatccctgcggagaaggttttcttg
gctcagaagatgatgattggacgctgcaacctggccggcaagcctgtcgtttgtgccaca
cagatgctggagagcatgatcactaaggctcgaccaactcgggcggagacaagcgatgtg
gccaatgccgtgctggatggggctgactgtatcatgctgtccggagagaccgccaagggc
agttttcctgtggaagctgtaatgatgcaacatgcgattgcgcgggaggcagaggccgct
gtgtaccaccgccagttgtttgaggagctacgccgggcagcgccgctgagccgtgaccca
actgaggtcactgcgattggagccgtggaggcttccttcaagtgctgtgcagcagccatc
atcgtgctgacgaagactggccgttcagcccagcttctatctcaataccgacctcgggcg
gctgtcattgctgtgactcgatctgcccaggctgcccgacaggtccacctgtcccgagga
gtcttccccttgctctaccgtgagcctccagaggccatctgggcagatgatgtggatcga
agggtccaatttggcattgaaagtggaaagctccgtggtttcctccgtgtgggtgatctg
gtgattgtggtgacaggttggcggcctggctctggctataccaacatcatgcgggtgctg
agcgtatcctga

DBGET integrated database retrieval system