KEGG   Rattus norvegicus (rat): 24827
Entry
24827             CDS       T01003                                 

Gene name
Tgfa, RATTGFAA, TGFAA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04915  Estrogen signaling pathway
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24827 (Tgfa)
   04012 ErbB signaling pathway
    24827 (Tgfa)
   04014 Ras signaling pathway
    24827 (Tgfa)
   04151 PI3K-Akt signaling pathway
    24827 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24827 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24827 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24827 (Tgfa)
   05212 Pancreatic cancer
    24827 (Tgfa)
   05225 Hepatocellular carcinoma
    24827 (Tgfa)
   05214 Glioma
    24827 (Tgfa)
   05211 Renal cell carcinoma
    24827 (Tgfa)
   05215 Prostate cancer
    24827 (Tgfa)
   05223 Non-small cell lung cancer
    24827 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24827 (Tgfa)
SSDB
Motif
Pfam: EGF TMEM154
Other DBs
NCBI-GeneID: 24827
NCBI-ProteinID: NP_036803
RGD: 3849
Ensembl: ENSRNOG00000016182
UniProt: P01134
LinkDB
Position
4q34
AA seq 159 aa
MVPAAGQLALLALGILVAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR
FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtccccgcggccggacagctcgctctgctagcgctgggtatcctggtagctgtgtgt
caggctctggagaacagcacgtcccccctgagtgactcacccgtggcggctgcagtggtg
tctcacttcaacaagtgcccagattcccacactcagtattgtttccatgggacctgcagg
tttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgc
tgtgagcatgcagatctcctggcagtggtggctgccagccagaagaagcaggccatcact
gccctggtggtagtctccattgtggccctggctgtcctcattatcacctgtgtgctgatc
cactgctgtcaggtccgcaagcactgtgagtggtgccgtgccctcgtctgcagacacgag
aagcccagcgccctcctgaaaggaaggactgcctgctgccactctgagacagtggtctga

DBGET integrated database retrieval system