KEGG   Rattus norvegicus (rat): 25163
Entry
25163             CDS       T01003                                 

Gene name
Cdkn2a, Arf, INK4A, MTS1, p16, p16Cdkn2a, p19ARF
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25163 (Cdkn2a)
   04115 p53 signaling pathway
    25163 (Cdkn2a)
   04218 Cellular senescence
    25163 (Cdkn2a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25163 (Cdkn2a)
   05206 MicroRNAs in cancer
    25163 (Cdkn2a)
   05203 Viral carcinogenesis
    25163 (Cdkn2a)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    25163 (Cdkn2a)
   05225 Hepatocellular carcinoma
    25163 (Cdkn2a)
   05214 Glioma
    25163 (Cdkn2a)
   05220 Chronic myeloid leukemia
    25163 (Cdkn2a)
   05218 Melanoma
    25163 (Cdkn2a)
   05219 Bladder cancer
    25163 (Cdkn2a)
   05223 Non-small cell lung cancer
    25163 (Cdkn2a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25163 (Cdkn2a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25163 (Cdkn2a)
   05163 Human cytomegalovirus infection
    25163 (Cdkn2a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25163 (Cdkn2a)
   01522 Endocrine resistance
    25163 (Cdkn2a)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 25163
NCBI-ProteinID: NP_113738
RGD: 2323
UniProt: Q9R0Z3
LinkDB
Position
5q32
AA seq 159 aa
MESSADRLARAAALGREHEVRALLEAGASPNAPNTFGRTPIQVMMMGNVKVAALLLSYGA
DSNCEDPTTLSRPVHDAAREGFLDTLVVLHQAGARLDVRDAWGRLPLDLALERGHHDVVR
YLRYLLSSAGNVSRVTDRHNFCSSTPRCLGLRGQPPKQR
NT seq 480 nt   +upstreamnt  +downstreamnt
atggagtcctctgcagatagactagccagggcagcggccctgggccgtgagcacgaggtg
cgggcactgctggaagccggggcttcaccaaacgccccgaacactttcggtcgtaccccg
atacaggtgatgatgatgggcaacgtcaaagtggcagctctcctgctctcctatggtgca
gattcgaactgcgaggaccccaccaccctctcccgaccggtgcacgacgcagcgcgggag
ggcttcctagacactctggtagtactgcaccaggcaggggcgcggctggatgtgcgcgat
gcctggggtcgcctgccgctcgacctggccctagagcggggacatcacgacgtcgtgcgg
tatttgcggtatctactctcctccgctgggaacgtttcccgggtcaccgacaggcataac
ttctgctcaagcacgcccaggtgcctaggacttcgaggccaacccccaaagcagcgctaa

DBGET integrated database retrieval system