KEGG   Rattus norvegicus (rat): 25238
Entry
25238             CDS       T01003                                 

Gene name
Grk2, Adrbk1, BARK1, GRK-2
Definition
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04724  Glutamatergic synapse
rno04740  Olfactory transduction
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    25238 (Grk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25238 (Grk2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    25238 (Grk2)
  09156 Nervous system
   04724 Glutamatergic synapse
    25238 (Grk2)
  09157 Sensory system
   04740 Olfactory transduction
    25238 (Grk2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25238 (Grk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     25238 (Grk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   25238 (Grk2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25238 (Grk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647
Other DBs
NCBI-GeneID: 25238
NCBI-ProteinID: NP_036908
RGD: 2062
Ensembl: ENSRNOG00000018985
UniProt: P26817
LinkDB
Position
1q43
AA seq 689 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFYLNHLEEAKPLVEFYEEIEKYEKLETEEERVVRSREIFDSYIMKELLAC
SHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFHKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEIKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEDEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggccgacctggaggcggtactggccgatgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgccagagcccagcatccgc
agcgtcatgcagaagtatctagaggatcgaggagaagtgacctttgaaaagatcttctca
cagaagttaggatacctgcttttccgggacttctacctgaaccatctggaagaggccaag
cccttggtggagttctatgaagagatcgagaaatatgagaagctggagacggaggaggaa
cgtgtggtccgcagccgggagatctttgactcctacatcatgaaagaactgctggcctgc
tcacatcccttttcaaagaatgccacggagcatgtccagggccacctggtgaagaagcag
gtacctccagatctcttccagccatacattgaggagatttgtcagaacctccgaggggat
gtgttccacaaattcattgagagtgacaagttcacacggttctgccagtggaagaatgta
gagctcaacatccacctgaccatgaatgacttcagtgtgcatcgaatcatcgggcgtggg
ggcttcggtgaggtctatgggtgccggaaagcagacacaggcaagatgtacgccatgaag
tgtctggacaagaaacgcatcaagatgaagcagggagagaccctggctctgaacgagcgg
atcatgctttccctcgtcagcactggggactgccccttcatcgtgtgcatgtcatatgca
ttccacacaccagacaagctcagtttcatcctggatctcatgaacggtggggacctgcac
taccacttgtctcagcatggagtcttctctgaagccgacatgcgcttctacgcagctgag
atcatcctgggccttgaacacatgcacaatcgctttgtagtctacagggacctaaagcca
gccaacattctcctggatgagcatggccatgtgagaatctcagacctgggcctagcctgt
gacttctccaagaagaagcctcatgccagtgtgggcacacacgggtacatggccccggaa
gtcctacagaagggcgtggcctatgacagcagtgccgactggttctccctgggctgcatg
ctcttcaagttgttgcggggacacagccccttccggcagcacaagaccaaagacaagcat
gagattgaccgcatgacattgacaatggctgttgagctgcctgactccttctcccctgaa
ctccgatccctgctggaaggtttgctgcagagggatgtcaatcggagactaggctgtctg
ggccgtggggctcaagagataaaagaaagccccttcttccgttccctggactggcagatg
gtcttcttacagaagtaccctcctccactgatccccccacgcggggaggtgaatgcagcg
gacgcctttgacattggctcctttgatgaggaggacacaaaaggaatcaagttactggac
agtgaccaggaactgtaccgcaacttccctctcaccatctctgagcggtggcaacaggag
gtggcagagactgtctttgataccatcaatgctgagacagaccggctggaggcacggaag
aaagccaaaaacaaacagctgggccacgaggaggactacgccctgggtaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcgatac
ttctacctgttccccaaccggcttgagtggaggggtgaagacgaggctccgcagagcctc
ctgaccatggaagagatccagtcggtggaagagacacagatcaaggaacgcaagtgtctc
ctgcttaagatccgaggtggcaagcagtttgtcctgcagtgtgatagtgaccctgagctg
gtgcaatggaaaaaagagctgcgcgatgcttaccgtgaggcccagcagctggtgcagcga
gtgcccaagatgaagaacaagccacgctcacctgtggtggagctgagcaaggtgccactg
attcagcgtggcagtgccaacggcctctga

KEGG   Rattus norvegicus (rat): 25372
Entry
25372             CDS       T01003                                 

Gene name
Grk3, Adrbk2
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04724  Glutamatergic synapse
rno04740  Olfactory transduction
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    25372 (Grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25372 (Grk3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    25372 (Grk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    25372 (Grk3)
  09157 Sensory system
   04740 Olfactory transduction
    25372 (Grk3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25372 (Grk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     25372 (Grk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   25372 (Grk3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25372 (Grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like
Other DBs
NCBI-GeneID: 25372
NCBI-ProteinID: NP_037029
RGD: 2063
Ensembl: ENSRNOG00000059456
UniProt: P26819
LinkDB
Position
12q16
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKVVLPEPSIRSVMQRYLAERNEITFDKIFN
QKIGFLLFKDFCLNEIGEAVPQVKFYEEIKEYEKLDNEEDRLHRSRQMYDAYIMRELLSS
THQFSKQAVEHVQSHLSKKQVTPTLFQPYIEEICESLRGDIFQKFMESEKFTRFCQWKNV
ELNIHLSMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRVKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDMHYHLSQHGVFSEKEMRFYASE
IILGLEHMHTCFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTCYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVQLPDAFSPE
LRSLLEGLLQRDVSQRLGCYGGGARELKEHIFFKGIDWQYVYLRKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLMISERWQQEVVETIYDAVNAETDKIEARK
KAKNKQLCQEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQIMSVEETQIKDRKCILLRVKGGKQFVLQCESDPEFAQWLKELTCTFNEAQRLLRR
APKFLNKPRAAILEFSKPPLCHRNSSGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgacgtcagctacctgatggccatggagaagagc
aaggcgacgccggccgcgcgcgccagcaagaaggtcgtcctgccggagcccagtatccgg
agtgtgatgcagaggtatctggcagaaagaaacgaaataacctttgacaagattttcaat
cagaaaatcggcttcctgctatttaaagatttctgcttgaatgaaatcggtgaagcggtg
cctcaggtgaaattttatgaagagataaaggaatacgagaaactggacaacgaagaagac
cggctgcaccggagtcggcagatgtacgacgcctacatcatgagggagcttctgtccagc
acacaccaattctcaaagcaagctgtagaacatgtccagagccatctctccaagaagcag
gtgacgcctaccctttttcagccgtacatagaagaaatctgcgaaagccttcgaggcgac
atcttccaaaagtttatggaaagcgaaaaattcactagattctgtcagtggaagaatgtg
gaattgaatattcatctgagcatgaacgacttcagtgtgcacaggatcatcggccgagga
gggtttggggaagtttacggctgcaggaaagcagacaccgggaaaatgtatgccatgaag
tgcttagacaagaagagagtgaagatgaaacagggagagacactggctttgaacgagagg
atcatgttgtctctcgtcagcactggggactgtcccttcattgtctgcatgacctatgcc
ttccacacaccagacaaactctgcttcatcctggacctgatgaacgggggcgacatgcac
taccacctctcccagcacggggtgttctctgagaaggagatgcgattttatgccagcgag
atcatcctgggcctcgagcacatgcacacctgctttgtagtctacagagacctgaagcct
gcgaacatcctcctggatgaatatgggcatgtgaggatatcggatcttggcctggcctgc
gatttctctaaaaagaagcctcacgccagtgtgggcacccatgggtacatggctcccgag
gtgttgcagaaggggacatgctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctcctgcggggccacagccctttcaggcagcataaaaccaaagacaagcat
gagatagaccgcatgaccctgaccgtgaacgtgcagcttccagatgccttctcccctgag
ctgaggtccctcttggagggtttgctccagcgggatgtgagccagcgactgggctgctac
ggaggaggggcacgagagttgaaggagcacatcttcttcaagggcatcgactggcagtat
gtgtacttacggaagtacccgccacccctaatccctcctcggggagaggtcaatgccgca
gacgcctttgatattggctcgtttgatgaagaagataccaaaggcattaagctgttggac
tgcgaccaggacctctataagaacttcccgctgatgatttctgagcgctggcagcaggaa
gtagtggagaccatctacgacgccgtcaatgccgaaactgataaaattgaggccaggaag
aaggctaaaaataaacagctttgtcaagaagaagattatgccatggggaaggactgcatc
atgcacggatacatgctgaagctggggaacccctttctcacacagtggcaaagacgttat
ttttacctgtttcccaacagactggagtggagaggagagggcgagtctcggcaaaatcta
ctgaccatggaacagatcatgtctgtggaggagacccaaattaaagacagaaaatgcatt
ttactcagggtaaaaggagggaagcagtttgttttgcaatgtgagagtgaccccgagttt
gcacagtggctgaaagagctgacgtgcaccttcaacgaggcccagagactgctgcgccgc
gcccccaagttcctcaacaaaccacgtgccgccatcctggagttctccaagccaccgctg
tgtcacagaaatagcagcggcctctga

DBGET integrated database retrieval system