KEGG   Rattus norvegicus (rat): 25267
Entry
25267             CDS       T01003                                 

Gene name
Pdgfra, APDGFR, PDGFACE
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25267 (Pdgfra)
   04014 Ras signaling pathway
    25267 (Pdgfra)
   04015 Rap1 signaling pathway
    25267 (Pdgfra)
   04630 JAK-STAT signaling pathway
    25267 (Pdgfra)
   04020 Calcium signaling pathway
    25267 (Pdgfra)
   04072 Phospholipase D signaling pathway
    25267 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    25267 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25267 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25267 (Pdgfra)
   04540 Gap junction
    25267 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25267 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25267 (Pdgfra)
   05206 MicroRNAs in cancer
    25267 (Pdgfra)
   05230 Central carbon metabolism in cancer
    25267 (Pdgfra)
   05231 Choline metabolism in cancer
    25267 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    25267 (Pdgfra)
   05218 Melanoma
    25267 (Pdgfra)
   05215 Prostate cancer
    25267 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25267 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25267 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25267 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25267 (Pdgfra)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25267 (Pdgfra)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   25267 (Pdgfra)
CD molecules [BR:rno04090]
 Proteins
  25267 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2
Other DBs
NCBI-GeneID: 25267
NCBI-ProteinID: NP_036934
RGD: 3284
Ensembl: ENSRNOG00000002244
UniProt: P20786 G3V6A0
LinkDB
Position
14p11
AA seq 1088 aa
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPM
SEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYV
PDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPDTEVTLHNNGRLVPASYDSRQGFNGT
FSVGPYICEATVRGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNNE
VVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVKE
MKTVTISVHEKGFVQIRPTFGHLETVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENLT
EITTDVQRSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDMKSYTFELSTLVPASILELV
DDHHGSGGGQTVRCTAEGTPLPNIEWMICKDIKKCNNDTSWTVLASNVSNIITEFHQRGR
STVEGRVSFAKVEETIAVRCLAKNDLGIGNRELKLVAPTLRSELTVAAAVLVLLVIVIVS
LIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSRHPEKPKKDLDIFGLNPADESTRSYV
ILSFENNGDYVDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEAKNL
LSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGVLLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKEWEGGLDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atggggacctcccaggcctttctggtcctcagctgtctcctcacagggccgagcctcatc
gtctgccagctcttattaccctccatccttccaaatgagaatgagaagattgtgccgctg
agttcgtccttctctctgagatgcttcggggagagcgaagtgagctggcagcaccccatg
tctgaagaagaggaccccaacgtggaaatcagaaccgaggagaacaacagtagcctcttt
gtcacggtgctggaagtggtcaacgcctcagcggcccacaccggatggtacacttgctat
tacaaccacactcagacagaagagagtgagatcgaaggcaggcacatttatatctatgta
ccagacccagacatggccttcgtgcctctcggcatgacggattctttagtcattgtggaa
gaggacgattctgccatcataccctgccgcaccacggatccagacactgaagtaaccttg
cacaataacgggaggctggtgcctgcctcctacgacagcaggcagggcttcaacggaacc
ttcagtgtggggccttacatctgtgaggccaccgtcagagggaggacgttcaagaccagc
gagtttaacgtttatgccttgaaagccacgtcagaactgaatctggagatggacacacgc
cagactgtgtataaggcaggagaaacgatcgtggtgacctgcgccgtctttaacaatgag
gtggttgacctgcagtggacttaccctggagaggtgagaaacaaaggcatcaccatgctg
gaggagatcaaactcccgtccatcaaactggtgtacacgctgaccgtccccaaggccacg
gtgaaggacagtggagattatgaatgtgctgcccgccaggccacgaaagaggtcaaggaa
atgaagacagtcaccatttctgttcacgagaaaggcttcgtccagatcaggcccaccttt
ggccatctggaaactgtgaacctgcatcaggtcagagagttcgtggtggaggtgcaggcc
tacccgacccccaggatatcctggctgaaggacaacttgaccctgattgagaatctcact
gagatcaccaccgatgtgcagaggagccaggagacgaggtatcaaagcaaattaaagctg
atccgggctaaggaagaagacagcggccattataccattatagttcagaatgacgacgac
atgaagagctacacgtttgagctgtcaactctagttcctgcctccattctggagcttgtg
gatgaccaccatggctctggcgggggacagactgtgaggtgcacggctgaaggcacccct
cttccgaacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacacttca
tggacagttttggccagcaacgtctcgaatattatcacggagttccaccagcgaggcagg
agtacagtggagggacgagtgtccttcgccaaggtggaagagaccatcgcagttcggtgc
ttggcaaagaacgaccttggcattgggaacagagagctgaagctggtggctcccaccctg
cgatctgagctcacggtggcggccgcggtgctggtgctgttggtgattgtcattgtctct
ctcattgtcctggttgtcatttggaagcagaaaccacggtatgaaattcgatggagggtc
attgagtcaatcagccctgatggacatgagtatatttatgtggaccccatgcagctgcct
tacgactccagatgggagttcccgagagatggactagtgcttggtcggatcttgggatcc
ggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccagcctgta
atgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgagaagcaagctctc
atgtctgagctgaagataatgactcacttgggaccgcatctgaacattgtgaatttgctg
ggagcctgcaccaagtcaggccccatttacatcatcacagaatactgcttctatggggat
ttggtcaattacctgcataagaacagagatagcttcatgagccgacacccagagaagcca
aagaaagacctggacatctttggattgaatcctgcagatgagagtaccaggagttacgtg
attttatcttttgaaaacaatggtgactacgtggacatgaagcaggctgacaccacacag
tacgtgccaatgctggaaaggaaggaggtttccaaatactccgacatccagagatcgctg
tacgatcggccggcctcctataagaagaaatccatgctagactcagaagctaaaaacctc
ctttcggatgatgactccgagggtctgactttgctggacctactaagcttcacctaccaa
gtggcccgagggatggaatttttggcttcgaaaaattgtgtccaccgggacctggctgcc
cgcaacgtccttctggcgcaggggaaaatcgtgaagatctgtgacttcgggctggccaga
gacatcatgcacgattctaactacgtgtcaaagggcagcactttcctgcctgtgaagtgg
atggcacctgagagcatttttgacaacctctacaccacgctgagtgacgtctggtcttat
ggcgttctgctctgggaaatattctcccttggtggcacaccctaccctggcatgatggtt
gattctactttctacaataagatcaagagcggatacaggatggccaaacccgaccatgcc
accagtgaagtctatgagattatggtgcagtgctggaacagtgaacccgaaaagagaccc
tccttctaccacctcagcgagatagtggagaatctgctgcctggacagtacaaaaagagt
tatgaaaagattcacctggacttcctaaagagtgaccatccggctgtggcacgcatgcgt
gtggactctgacaacgcgtacatcggtgtcacttacaaaaatgaagaggacaagctgaag
gaatgggaaggtggcctggatgaacagagattgagcgcagatagtggctacatcattccc
ctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacacagc
tcgcagacttcggaagagagcgccatcgagacgggttccagtagttccactttcatcaag
agagaggacgagaccattgaggacatcgacatgatggatgatattggcatagattcctca
gacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system