KEGG   Rattus norvegicus (rat): 25273
Entry
25273             CDS       T01003                                 

Gene name
Smo, Smoh
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04360  Axon guidance
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    25273 (Smo)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    25273 (Smo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25273 (Smo)
   05205 Proteoglycans in cancer
    25273 (Smo)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    25273 (Smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25273 (Smo)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  25273 (Smo)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 25273
NCBI-ProteinID: NP_036939
RGD: 3726
Ensembl: ENSRNOG00000008332
UniProt: P97698
LinkDB
Position
4q22
AA seq 793 aa
MAAGRPVRGPELAPRRLLQLLLLVLLGGRGRGAALSGNVTGPGPRSAGGSARRNAPVTSP
PPPLLSHCGRAAHCEPLRYNVCLGSALPYGATTTLLAGDSDSQEEAHSKLVLWSGLRNAP
RCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPE
GCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAA
FGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCR
ADGTMRFGEPTSSETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGK
TSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGG
YFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFN
QAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWV
WTKATLLIWRRTWCRLTGHSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSH
DGPVAGLAFELNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANLWL
VEAEISPELEKRLGRKKKRRKRKKEVCPLGPAPELHHSAPVPATSAVPRLPQLPRQKCLV
AANAWGTGEPCRQGAWTVVSNPFCPEPSPHQDPFLPGASAPRVWAQGRLQGLGSIHSRTN
LMEAELLDADSDF
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggctgctggccgccccgtgcgtgggcccgagctggcgccccggaggctgctgcagttg
ctgctgctggtactgcttgggggccggggccggggggcggccttgagcgggaacgtgacc
gggcctgggcctcgcagtgccggcgggagcgcgaggaggaacgcgccggtgaccagccct
ccgccgccgctgctgagccactgcggccgggccgcccactgcgagcctttgcgctacaac
gtgtgcctgggctccgcgctgccctacggagccaccaccacgctgctggctggggactcg
gactcgcaggaggaagcgcacagcaagctcgtgctctggtccggcctccggaatgctccc
cgatgctgggcagtgatccagcccctgctgtgtgctgtctacatgcccaagtgtgaaaat
gaccgagtggagttgcccagccgtaccctctgccaggccacccgaggcccctgtgccatt
gtggagcgggaacgagggtggcctgactttctgcgttgcacgccggaccacttccctgaa
ggctgtccaaacgaggtacaaaacatcaagttcaacagttcaggccaatgtgaagcaccc
ttggtgaggacagacaaccccaagagctggtacgaggacgtggagggctgtgggatccag
tgccagaacccgctgttcaccgaggctgagcaccaggacatgcacagttacatcgcagcc
ttcggggcggtcaccggcctctgtacactcttcaccctggccacctttgtggctgactgg
cggaactccaatcgctaccctgcggttattctcttctatgtcaatgcgtgtttctttgtg
ggcagcattggctggctggcccagttcatggatggtgcccgccgggagattgtttgccga
gcagatggcaccatgagatttggggagcccacctccagcgagaccctatcctgtgtcatc
atctttgtcatcgtgtactatgccttgatggctggagtagtgtggttcgtggtcctcacc
tatgcctggcacacctccttcaaagccctgggcaccacttaccagcctctctcgggcaag
acatcctatttccacctgctcacgtggtcactccccttcgtcctcactgtggcaatcctt
gctgtggctcaggtagatggggactccgtgagtggcatctgctttgtaggctacaagaac
tatcggtaccgtgctggctttgtacttgccccaattggcctggtgcttattgtgggaggc
tacttcctcatccgaggggtcatgactctgttctccatcaagagcaaccaccctgggctt
ctgagtgagaaggcagccagcaagatcaatgagaccatgctgcgcctgggcatttttggc
ttcctcgcctttggcttcgtgctcatcaccttcagctgccacttctatgacttcttcaac
caggctgagtgggagcgtagcttccgggactatgtgctatgccaagccaatgtgaccatt
gggctgcctaccaagaagcccattcctgattgtgagatcaagaatcggcccagcctcctg
gtggagaagatcaatctgtttgccatgtttggcactggcattgccatgagcacctgggtc
tggaccaaggccaccctgctcatctggaggcgcacctggtgcaggttgactgggcacagt
gatgatgaacccaagagaatcaagaaaagcaagatgattgccaaggccttctctaagcgg
cgtgaactgctgcagaacccgggccaggagctctccttcagcatgcacactgtctcccat
gatggacctgttgccggtttggcttttgaactcaatgaaccctcagctgatgtctcctct
gcctgggcccagcacgtcaccaagatggtggctcgaagaggagccatattaccccaggat
gtgtctgtcacccctgtggcaactccagtgccaccagaagaacaagccaacctgtggctg
gttgaggcagagatctccccagagttagagaagcgtttaggccggaagaagaagcggagg
aagaggaagaaggaggtgtgccccttggggccagcccctgaacttcaccactctgcccct
gttcctgccaccagtgcagttcctcggctgcctcagctgcctcggcagaagtgcctagta
gctgcaaatgcctggggaacaggagagccctgccgacagggagcctggactgtagtctcc
aaccccttctgcccagagcctagtccccatcaagatccatttctccctggtgcctcagcc
cccagggtctgggctcagggccgcctccaggggctgggatccattcattcccgcactaac
ctaatggaggctgagctcttggatgcagactcggacttctga

DBGET integrated database retrieval system