KEGG   Rattus norvegicus (rat): 25317
Entry
25317             CDS       T01003                                 

Gene name
Fgf1, FGF-1, HBGF-1, HBGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25317 (Fgf1)
   04014 Ras signaling pathway
    25317 (Fgf1)
   04015 Rap1 signaling pathway
    25317 (Fgf1)
   04390 Hippo signaling pathway
    25317 (Fgf1)
   04151 PI3K-Akt signaling pathway
    25317 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25317 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25317 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    25317 (Fgf1)
   05218 Melanoma
    25317 (Fgf1)
   05224 Breast cancer
    25317 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25317 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25317 (Fgf1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25317 (Fgf1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25317 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 25317
NCBI-ProteinID: NP_036978
RGD: 2605
Ensembl: ENSRNOG00000013867
UniProt: P61149
LinkDB
Structure
PDB: 
2UUS 2J3P

Position
18p11
AA seq 155 aa
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggagatcacaacctttgcagccctgaccgagaggttcaatctgcctcta
gggaactacaaaaaacccaaactgctctactgcagcaacgggggccacttcttgaggatt
cttcccgatggcaccgtggatgggaccagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgcgggcgaagtgtatataaagggtacagagactggccagtacttg
gccatggacaccgaagggcttttatacggctcgcagacaccaaatgaagaatgcctattc
ctggaaaggctagaagaaaaccattataacacttacacatccaagaagcacgcggagaag
aactggtttgtgggcctcaagaagaacgggagttgtaagcgcggtcctcggactcactac
ggccagaaagccatcttgtttctccccctcccggtatcttctgactaa

DBGET integrated database retrieval system