KEGG   Rattus norvegicus (rat): 29216
Entry
29216             CDS       T01003                                 

Gene name
Lrp2
Definition
(RefSeq) LDL receptor related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04918  Thyroid hormone synthesis
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    29216 (Lrp2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    29216 (Lrp2)
  09154 Digestive system
   04979 Cholesterol metabolism
    29216 (Lrp2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    29216 (Lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 SGL EGF_CA
Other DBs
NCBI-GeneID: 29216
NCBI-ProteinID: NP_110454
RGD: 68407
Ensembl: ENSRNOG00000056184
UniProt: P98158
LinkDB
Structure
PDB: 
2I1P

Position
3q21
AA seq 4660 aa
MERGAAAAAWMLLLAIAACLEPVSSQECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEI
GCPPRSCESGLFLCPAEGTCIPSSWVCDEDKDCSDGADEQQNCAGTTCSAQQMTCSNGQC
IPSEYRCDHVSDCPDGSDERNCHYPTCDQLTCANGACYNTSQRCDQKVDCRDSSDEANCT
TLCSQKEFECGSGECILRAYVCDHDNDCEDNSDERNCNYDTCGGHQFTCSNGQCINQNWV
CDGDDDCQDSGDEDGCESNQSHHRCYPREWACPGSGRCISIDKVCDGVPDCPEGDDENNV
TSGRTCGMGVCSVLNCEYQCHQTPFGGECFCPPGHIINSNDSRTCIDFDDCQIWGICDQK
CENRQGRHQCLCEEGYILERGQHCKSSDSFSAASVIFSNGRDLLVGDLHGRNFRILAESK
NRGMVMGVDFHYQKHRVFWTDPMQEKVFSTDINGLNTQEILNVSVDTPENLAVDWINNKL
YLVETKVNRIDVVNLEGNQRVTLITENLGHPRGIALDPTVGYLFFSDWGSLSGQPKVERA
FMDGSNRKDLVTTKVGWPAGITLDLVSKRVYWVDSRYDYIETVTYDGIQRKTVARGGSLV
PHPFGISLFEEHVFFTDWTKMAVMKASKFTETNPQVYHQSSLRPHGVTVYHALRQPNATN
PCGSNNGGCAQVCVLSHRTDNGGLGYRCKCEFGFELDDDEHRCVAVKNFLLFSSKTAVRG
IPFTLSTQEDVMVPVTGSPSFFVGIDFDAQHSTVFYSDLSKDIIYKQKIDGTGKEVITAN
RLESVECLTFDWISRNLYWTDGGLKSVTVLRLADKSRRQIISNLNNPRSIVVHPTAGYMF
LSDWFRPAKIMRAWSDGSHLMPIVNTSLGWPNGLAIDWSASRLYWVDAFFDKIEHSTLDG
LDRKRLGHVDQMTHPFGLTVFKDNVFITDWRLGAIIRVRKSDGGDMTVIRRGISSVMHVK
AYDADLQTGSNYCSQTTHANGDCSHFCFPVPNFQRVCGCPYGMKLQRDQMTCEGDPAREP
PTQQCGSLSFPCNNGKCVPSFFRCDGVDDCHDNSDEHQCGVFNNTCSPSAFACVRGGQCI
PGQWHCDRQNDCLDGSDEQNCPTHATSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSD
EKNCQASGTCQPTQFRCPDHRCISPLYVCDGDKDCADGSDEAGCVLNCTSAQFKCADGSS
CINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIHG
SDEHTGCVPKTCSPTHFLCDNGNCIYKAWICDGDNDCRDMSDEKDCPTQPFHCPSTQWQC
PGYSTCINLSALCDGVFDCPNGTDESPLCNQDSCSHFNGGCTHQCMQGPFGATCLCPLGY
QLANDTKTCEDINECDIPGFCSQHCVNMRGSFRCACDPEYTLESDGRTCKVTGSENPLLV
VASRDKIIVDNITAHTHNLYSLVQDVSFVVALDFDSVTGRVFWSDLLQGKTWSVFQNGTD
KRVVHDSGLSVTEMIAVDWIGRNLYWTDYALETIEVSKIDGSHRTVLISKNVTKPRGLAL
DPRMGDNVMFWSDWGHHPRIERASMDGTMRTVIVQEKIYWPCGLSIDYPNRLIYFMDAYL
DYIEFCDYDGHNRRQVIASDLVLHHPHALTLFEDFVYWTDRGTRQVMQANKWHGGNQSVV
MYSVHQPLGITAIHPSRQPPSRNPCASASCSHLCLLSAQAPRHYSCACPSGWNLSDDSVN
CVRGDQPFLMSVRDNIIFGISLDPEVKSNDAMVPISGIQHGYDVEFDDSEQFIYWVENPG
EIHRVKTDGSNRTVFAPLSLLGSSLGLALDWVSRNIYYTTPASRSIEVLTLKGDTRYGKT
LIANDGTPLGVGFPVGIAVDPARGKLYWSDHGTDSGVPAKIASANMDGTSLKILFTGNLQ
HLEVVTLDIQEQKLYWAVTSRGVIERGNVDGTERMILVHHLAHPWGLVVYGSFLYYSDEQ
YEVIERVDKSSGNNKVVLRDNVPYLRGLRVYHRRNAADSSNGCSNNPNACQQICLPVPGG
MFSCACASGFKLSPDGRSCSPYNSFMVVSMLPAVRGFSLELSDHSEAMVPVAGQGRNVLH
ADVDVANGFIYWCDFSSSVRSSNGIRRIKPDGSNFTNVVTYGIGANGIRGVALDWAAGNL
YFTNAFVYETLIEVLRINTTYRRVLLKVSVDMPRHIIVDPKHRYLFWADYGQKPKIERSF
LDCTNRTVLVSEGIVTPRGLAMDHDTGYIYWVDDSLDLIARIHLDGGESQVVRYGSRYPT
PYGITVFGESIIWVDRNLKKVFQASKQPGNTDPPVVIRDKINLLRDVTIFDEHAQPLSPA
ELNNNPCLQSNGGCSHFCFALPELPTPRCGCAFGTLGNDGKSCATSQEDFLIYSLNNSLR
SLHFDPRDHSLPFQVISVAGTAIALDYDRRNNRIFFTQKLNSLRGQISYVSLYSGSSSPT
VLLSNIGVTDGIAFDWINRRIYYSDFSNQTINSMAEDGSNRAVIARVSKPRAIVLDPCRG
YMYWTDWGTNAKIERATLGGNFRVPIVNTSLVWPNGLALDLETDLLYWADASLQKIERST
LTGTNREVVVSTAFHSFGLTVYGQYIYWTDLYTRKIYRANKYDGSDLVAMTTRLPTQPSG
ISTVVKTQRQQCSNPCDQFNGGCSHICAPGPNGAECQCPHEGNWYLANDNKYCVVDTGTR
CNQLQFTCLNGHCINQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCGNGRCVPYHYR
CDYYNDCGDNSDEAGCLFRNCNSTTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCPP
HTCPPDFTKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQCLSPQRCIP
SYWFCDGEADCADGSDEPDTCGHSVNTCRASQFQCDNGRCISGNWVCDGDNDCGDMSDED
QRHHCELQNCSSTQFTCVNSRPPNRRCIPQYWVCDGDADCSDALDELQNCTMRTCSAGEF
SCANGRCVRQSFRCDRRNDCGDYSDERGCSYPPCHANQFTCQNGRCIPRFFVCDEDNDCG
DGSDEQEHLCHTPEPTCPLHQFRCDNGHCIEMGRVCNHVDDCSDNSDEKGCGINECLDSS
ISRCDHNCTDTITSFYCSCLPGYKLMSDKRSCVDIDECKESPQLCSQKCENVVGSYICKC
APGYIREPDGKSCRQNSNIEPYLIFSNRYYIRNLTTDGSSYSLILQGLGNVVALDFDRVE
KRLYWIDAEKQIIERMFLNKTNRETIINHRLRRAESLAVDWVSRKLYWLDAILDCLFVSD
LEGRHRKMIAQHCVDANNTFCFEHPRGIVLHPQRGHVYWADWGVHAYIGRIGMDGTNKSV
IISTKIEWPNAITIDYTNDLLYWADAHLGYIEFSDLEGHHRHTVYDGSLPHPFALTIFED
TVFWTDWNTRTVEKGNKYDGSGRVVLVNTTHKPFDIHVYHPYRQPIMSNPCGTNNGGCSH
LCLIKAGGRGFTCACPDDFQTVQLRDRTLCMPMCSSTQFLCGNNEKCIPIWWKCDGQKDC
SDGSDEPDLCPHRFCRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCESNE
WQCANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRTCRPGQFKCNNGRCIPQSWKCDVDN
DCGDYSDEPIDECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVP
CHPSGDFRCANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSESEFRCADQQCIPSRWVC
DQENDCGDNSDERDCEMKTCHPEHFQCTSGHCVPKALACDGRADCLDASDESACPTRFPN
GTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPQRFRCDNSRCVY
GHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLSD
ETGCNLGDNRTCAENICEQNCTQLSSGGFICSCRPGFKPSTSDKNSCQDINECEEFGICP
QSCRNSKGSYECFCVDGFKSMSTHYGERCAADGSPPLLLLPENVRIRKYNTSSEKFSEYL
EEEEHIQTIDYDWDPEHIGLSVVYYTVLAQGSQFGAIKRAYIPNFESGSNNPIREVDLGL
KYLMQPDGLAVDWVGRHIYWSDAKSQRIEVATLDGRYRKWLITTQLDQPAAIAVNPKLGL
MFWTDQGKQPKIESAWMNGEHRSVLVSENLGWPNGLSIDYLNDDRVYWSDSKEDVIEAIK
YDGTDRRLIINEAMKPFSLDIFEDKLYWVAKEKGEVWRQNKFGKENKEKVLVVNPWLTQV
RIFHQLRYNQSVSNPCKQVCSHLCLLRPGGYSCACPQGSDFVTGSTVQCDAASELPVTMP
PPCRCMHGGNCYFDENELPKCKCSSGYSGEYCEVGLSRGIPPGTTMAVLLTFVIVIIVGA
LVLVGLFHYRKTGSLLPTLPKLPSLSSLAKPSENGNGVTFRSGADVNMDIGVSPFGPETI
IDRSMAMNEHFVMEVGKQPVIFENPMYAAKDNTSKVALAVQGPSTGAQVTVPENVENQNY
GRPIDPSEIVPEPKPASPGADEIQGKKWNIFKRKPKQTTNFENPIYAEMDSEVKDAVAVA
PPPSPSLPAKASKRNLTPGYTATEDTFKDTANLVKEDSDV
NT seq 13983 nt   +upstreamnt  +downstreamnt
atggagcgcggggccgcagcggcggcgtggatgctgttgctggcgatcgctgcctgcctg
gagccagtcagtagccaagaatgcggcagtgggaattttcgctgtgacaatggatactgt
atccctgcgtcctggaggtgtgatgggaccagagactgtttggatgacacagatgaaatt
ggctgtcctcccaggtcctgcgaatcaggccttttcctgtgtcctgctgaggggacctgc
atccctagctcctgggtgtgtgacgaggataaggattgttcggacggtgcagacgaacag
caaaattgtgctgggaccacgtgctcggctcagcagatgacgtgctccaacggtcagtgt
attccgagcgaatacaggtgcgaccatgtcagcgactgccccgacggctctgacgagaga
aactgccattatccaacatgtgatcaacttacttgtgccaatggagcctgctataacacg
agtcagaggtgtgaccaaaaagttgactgcagggattcctcggacgaagctaactgcact
accctgtgttcgcaaaaagaatttgaatgtggcagtggagagtgtatccttcgcgcctac
gtctgtgaccatgacaatgactgcgaagataacagcgatgagcgcaattgcaactatgac
acctgcggaggtcaccagttcacttgctccaatggccagtgcatcaaccagaactgggtt
tgtgatggagatgacgactgccaagattctggtgatgaagatggatgtgaaagtaaccag
agtcatcataggtgttacccaagagaatgggcgtgtcctgggtctggacgatgcatctca
attgataaagtttgcgatggagttcctgactgtccagaaggagacgatgagaacaacgtc
acaagcggaagaacctgtggtatgggtgtctgctctgtcttaaactgtgagtaccagtgc
catcagacgccatttggaggagaatgcttctgccccccaggtcatattatcaacagcaat
gacagccgtacttgcattgatttcgacgactgccagatatggggaatttgtgaccagaag
tgtgaaaaccgacagggccgtcatcagtgcctctgtgaagaagggtatatcctggagcga
gggcagcattgcaaatccagtgactccttcagtgcagcctctgttatcttctccaatggt
cgggatttgctagttggagatcttcatggaagaaacttccggattctagcagagtctaag
aaccgaggaatggttatgggagtggattttcactatcagaaacacagagttttttggaca
gaccccatgcaggaaaaggtgttttccactgacatcaatggcttaaatacccaagaaatt
cttaatgtttctgttgacactccagagaatctggctgtggattggattaataataaactt
tatctggtagagacaaaggtcaaccgcattgacgtggtcaacttggagggaaatcagcgt
gttactctcataactgaaaacttagggcatcctagaggaattgcccttgatccaactgtg
ggctatttgtttttctcagattggggaagcctctctgggcaacccaaggtggagagagcc
ttcatggatggtagcaatcggaaagacctggtaacaaccaaagtggggtggcctgctggg
atcactctggatctggtgtccaagcgagtttactgggtggattctcgttatgactacatt
gaaactgtaacatatgacggaattcaaaggaagacggtagctcgtggaggctcccttgtt
ccgcatccctttggaataagcttatttgaggaacacgtgttctttactgattggacaaag
atggctgtgatgaaagccagcaagttcacagaaaccaaccctcaagtgtaccaccagtct
tccctgaggcctcacggagtgacggtttaccatgccctcaggcaacccaatgccaccaat
ccgtgcgggagcaacaatgggggctgtgcgcaggtctgtgtcctcagtcacaggacggat
aatggtggcctgggctaccggtgcaagtgtgaattcggctttgaactggatgatgatgag
caccgctgtgttgccgttaagaacttcctgctcttctcatcgaaaacggctgtgcgtgga
atcccattcaccctctccacccaggaagatgtcatggttcctgtcacagggagtccatcc
ttcttcgttggaattgattttgatgcccaacacagtactgtcttctattcagatttgtca
aaagacataatttataaacaaaaaattgatggcacaggaaaagaggttatcacagcaaac
cggttggaaagtgttgagtgtttgacttttgactggatctcaaggaatctttactggaca
gatggaggactaaagagtgtcactgtcctgaggctggctgataagtcccgacgacagata
atcagcaacttaaacaaccctcgttccattgtggtgcatccgaccgctgggtatatgttc
ctgagtgattggttccgtcctgcaaaaattatgagagcatggagcgatggttctcaccta
atgcccatagtcaatactagtctggggtggcccaatggcttggccatcgattggagtgct
tcacgattgtactgggtagatgccttttttgataagattgaacacagcacccttgatggt
ttagatagaaaaaggctgggccatgtagaccagatgactcatccatttggactcaccgtt
tttaaagataatgtgttcataacagactggagactgggtgctattattcgagtgaggaaa
tcagatggtggtgatatgacagttattcgaagaggcatcagcagcgtaatgcacgtgaaa
gcctacgatgctgacctccagactgggtctaactactgcagtcagaccacccacgccaac
ggtgactgcagccacttctgcttcccggtcccgaacttccagcgggtgtgcggctgtccc
tatggaatgaagcttcagagggatcaaatgacttgtgagggagacccagcccgagagcca
cccacacagcagtgtggctccctctcctttccctgcaacaatggcaagtgtgtgcccagt
ttcttccgctgtgatggagtggacgattgccatgacaacagtgatgagcatcagtgcggg
gtgtttaataatacttgctcaccttcggctttcgcctgcgtccgcggtggacagtgcatc
cctggccagtggcactgtgacagacagaatgactgtttagacggcagtgatgagcaaaac
tgccccacacatgccacgtcgtccacttgcccgtccacctccttcacctgcgacaatcac
gtgtgcatcccaaaagactgggtctgtgacacagacaatgattgctcggatggctcggat
gaaaagaactgccaagcttcagggacctgccagcctacacagtttcggtgccctgaccac
cgatgcatcagcccgctgtatgtctgtgatggggacaaggactgcgcggatgggtctgat
gaggcgggctgtgtgttaaactgtacgagtgcccagttcaaatgtgccgatgggagttct
tgcattaacagcaggtaccgctgcgatggggtttacgactgcagggacaactctgacgag
gcaggctgccccaccaggcctcccggcatgtgccacccggatgagttccagtgccaagga
gacggtacatgcatccctaacacctgggagtgtgacgggcatccagactgtatccacggg
tccgacgagcacactggctgtgttcctaagacctgctcgccgactcatttcctctgtgac
aatggaaactgcatctacaaagcgtggatctgtgatggggacaatgattgtagggatatg
agtgatgagaaggactgtcctacccagccttttcactgtcctagcacgcagtggcagtgc
ccgggctacagcacctgtatcaatctgagtgccctgtgtgacggcgtctttgactgtccg
aatgggactgacgagtccccactttgcaatcaagacagctgctcccattttaatggtggc
tgtactcatcagtgcatgcaagggcccttcggagccacatgcctatgcccattaggatac
caacttgccaatgataccaagacctgtgaagatatcaatgagtgcgatattccaggcttc
tgcagccagcactgcgtcaacatgagaggttccttccggtgcgcttgtgatccagaatat
acgctggaaagtgatgggcggacttgcaaagtcacaggatctgaaaatccgttgttagtt
gtagcaagtcgtgacaaaatcattgtggacaacatcactgcccacacgcacaatctctac
tcgttggtccaggatgtttcttttgtggttgctcttgattttgattcagtcactggtcgt
gtcttctggagtgacttactgcagggtaaaacctggagtgtctttcaaaacggaacagac
aagagagtggtccatgacagtggcctctctgtgacagaaatgattgcagtagattggatt
ggtcgcaacctttactggacggactatgctcttgaaacaatcgaagtttctaaaattgat
ggaagtcacagaacagtactgatcagcaaaaatgtcacaaaaccgaggggactcgcgtta
gatcccagaatgggtgacaatgtaatgttttggtctgactggggccatcaccctcgcatt
gagcgagccagcatggatggcaccatgcgcacagtcattgtccaggaaaagatctactgg
ccctgtggcttaagcatcgactaccccaaccgcctcatctacttcatggatgcctatctt
gactacattgaattctgtgattacgacggacataaccgaaggcaggtcattgctagcgat
ttggttctccaccatccgcacgccctcactctgttcgaagactttgtgtactggactgac
cgtggtactcggcaggttatgcaggccaacaagtggcatggggggaaccagtcagttgta
atgtacagcgttcaccaaccgcttggaataactgccattcatccttcaaggcaaccacct
tcccggaatccatgtgcctctgcctcttgcagccatctttgcctgctttctgcacaggcg
cctagacattattcttgtgcttgcccttcaggatggaacctctccgatgattctgtcaac
tgtgtgagaggtgaccaacctttcttgatgtccgtaagagacaatataatttttggaatc
tcccttgatcctgaggtgaagagcaatgatgccatggtccccatatcagggatacagcat
ggttatgatgttgaatttgatgactctgagcaattcatctactgggttgagaatccgggt
gaaattcacagagtgaagactgatggcagcaacaggacagtgtttgctcctctgtccctg
ctggggtcttctttaggcctggccttggactgggtatcaaggaacatttattataccact
cctgcaagtcggtccattgaggtgttgacgctcaagggagatacgaggtatggaaaaacc
ctgattgccaatgacggcacccccctcggagttggtttccccgttggcatagctgttgat
cctgcacgtgggaaactatattggtcagaccacgggacggacagtggggttcctgccaag
atcgcaagtgctaatatggatggaacatctttaaaaattctcttcactgggaacctgcag
catctggaggttgtcaccctggacattcaggagcagaagctgtactgggcagtcaccagc
agaggcgtgattgagagaggaaatgtggacggtacagagaggatgatcctggtgcaccat
ctggcccacccatggggccttgtggtctatggctccttcctttactactctgatgaacag
tatgaggtcattgagagagttgacaagtcctctgggaataacaaagtcgtcctcagagat
aacgttccgtacctgaggggtcttcgggtttaccaccgccgcaatgccgctgactcttcc
aatggctgtagcaacaaccccaacgcttgccagcagatctgcctgcccgtgccaggtgga
atgttctcctgcgcctgtgccagtggctttaagctcagccctgacggtcgctcctgttct
ccatataactcgttcatggtcgtttccatgctgcccgcagttagaggctttagcttggag
ttgtctgatcactcggaggccatggtgcccgtagctggccaaggacgaaatgttctgcat
gcggacgtggatgttgccaacggctttatttactggtgtgattttagcagctctgtaaga
tcctctaatggaattcgtagaatcaaacccgacgggtctaattttaccaacgtcgttacc
tatggcattggggcaaatggaatccggggtgttgcactggactgggcagcaggaaatctt
tattttaccaatgcctttgtgtacgaaaccctgatagaagtgttacggatcaataccacg
taccgccgtgtactcctcaaagtctcagtggatatgccccggcatattattgttgacccc
aagcatagatatctcttctgggccgactatgggcagaagccaaagatcgaacgctctttt
cttgactgtaccaatcgaactgtccttgtttccgaaggcattgtcacccctcggggcttg
gccatggaccatgacactggctatatttattgggttgatgactccttagatttaattgcc
aggatccatcttgatggaggagaatctcaggtggttcgctatggcagccgttacccaact
ccctatggcatcactgtgtttggagagtctatcatttgggtggatagaaacttgaaaaaa
gtcttccaagccagcaagcaaccagggaatacagatccacccgtagtgataagagataag
atcaacctgctccgtgacgtgaccatctttgacgagcacgcccagcccctctcaccagca
gagcttaacaataacccttgtctgcaaagcaatggtgggtgttcccacttttgctttgcc
ttacctgagttgcctactcccagatgtggatgtgcttttgggactctgggaaatgatggc
aagagctgtgctacctcccaagaagatttcctcatctattccttaaataattccctgaga
agtttacactttgaccctagagaccatagcctacctttccaagtgataagtgtggcggga
actgccattgcactggattatgaccgtagaaacaatagaatcttcttcacacaaaagcta
aactctctccgtggccagatttcctatgtcagcctgtattcagggagcagctctccaact
gtcctgctgtcaaatataggggtgactgatggcattgcctttgattggataaatagaaga
atttattacagtgacttttcaaatcagacaataaattccatggctgaagatggatccaat
cgtgctgtgattgcccgtgtttccaaacccagagctattgtattagatccttgccgaggg
tacatgtattggactgactggggtaccaacgccaaaatcgagagagccacactgggagga
aacttccgggtccccattgtgaacaccagcttggtttggcccaatggactcgctttggac
cttgagactgaccttctgtactgggcagatgctagcttgcagaaaatagaacgcagtact
ctcacgggcacgaaccgagaagtcgttgtcagcactgcctttcattcctttggcttgact
gtctatggccagtacatttactggacagacttgtacaccagaaaaatctaccgggctaac
aagtacgacgggtcagacctggtagcaatgaccacacgtttgcccacccagcctagtggt
atttccacagtggtcaaaacccagcggcagcagtgtagcaatccttgtgaccagttcaac
ggaggatgcagccatatctgtgctccaggtccaaatggagctgagtgtcagtgtcctcac
gaaggcaactggtatctggccaacgataacaagtactgcgttgtggacacggggacccgc
tgtaatcaactccagttcacctgcctcaatgggcattgtattaatcaggattggaaatgt
gacaatgacaacgactgtggtgatggcagtgatgagcttcctacagtctgtgcctttcac
acctgccgatcaacagccttcacttgtggcaacgggcgatgtgtgccataccactatcgc
tgtgattactacaatgactgcggggacaacagcgacgaggcaggttgcctgttcagaaac
tgcaacagcaccacagagttcacgtgcagcaatgggcggtgcataccgctcagttatgtc
tgcaatggcataaacaattgccatgacaatgacacctcggatgagaaaaactgccctccc
cacacttgcccgccggatttcacaaaatgccagaccacgaatatttgtgttccccgagct
ttcttgtgtgatggagacaatgactgtggagacgggagtgacgagaaccccatttactgc
gcctcacacacatgccgcagcaacgagttccagtgcctctcccctcagcggtgtattcca
agctattggttctgtgacggtgaagccgactgtgcagatggctcggatgaacctgacact
tgtgggcattctgtgaacacctgcagggccagtcagttccagtgtgataatggcaggtgc
atctcaggcaattgggtctgtgatggtgataacgactgtggggacatgagtgacgaggac
cagcggcatcactgtgagcttcagaactgttccagcactcagtttacctgtgtcaacagc
agacctcccaacaggaggtgcatcccacagtactgggtctgtgacggtgatgcggactgc
tcggacgccctggacgagctgcagaattgcaccatgagaacctgctctgcaggggagttc
agctgtgcaaatggacgatgtgtcaggcagtcattcaggtgtgatcggcgcaatgactgt
ggagactacagtgatgagaggggctgctcgtacccaccctgccatgcaaatcaatttacg
tgtcagaacgggcggtgtatccctaggttctttgtttgtgatgaggacaatgactgtgga
gatggttctgatgagcaggagcacctgtgtcacaccccagaacccacatgcccccttcat
caattccggtgtgacaacgggcactgcatcgagatggggcgagtctgtaaccatgtggac
gactgctcagacaacagcgatgagaaaggctgtggcattaacgagtgcctagattcttca
atcagtcgctgtgaccacaactgtacagataccataactagtttctactgttcctgtctc
cctggctacaagctcatgtctgacaaacgctcttgcgtggatattgacgaatgcaaggag
tcaccccagctctgtagccagaagtgtgagaatgtggtaggctcctatatttgcaagtgt
gcccctggctacatccgtgagccagatgggaagagctgccggcagaatagtaacatcgag
ccctatctcatctttagcaaccgttactatataagaaacttaactacagatggctcatct
tactccctgattttgcaaggattgggcaatgttgtggccctggactttgatagagtagaa
aagaggctgtattggattgatgcagagaagcaaatcattgagaggatgtttttgaataag
acaaaccgggagaccatcataaaccacaggttaagacgtgctgaaagtctggctgtagac
tgggtcagcagaaaactctattggttggatgccatcttggactgcctgtttgtctctgac
cttgaaggtcgacaccgcaaaatgatagcccagcactgtgtggatgctaacaataccttc
tgctttgaacatcccaggggaattgtccttcatcctcaaagagggcatgtctactgggca
gattggggtgttcacgcatacattggaaggattggcatggatggaaccaataagtctgtg
atcatctctaccaagatagaatggcccaatgccatcaccattgactacaccaacgatctc
ttgtactgggcagatgctcacctgggttatatcgagttctctgatttggaaggtcaccac
cgacacacggtgtacgatggatcactgcctcacccctttgctcttacgatttttgaagac
actgttttttggacagattggaatacacggacggttgaaaagggaaacaaatatgatggg
tcaggtcgagtggtgctggtgaacacaacgcacaaacccttcgacatccacgtgtaccat
ccataccggcagccgattatgagcaatccctgtggtaccaacaacggtggctgttctcat
ctgtgcctcatcaaagcgggggggagaggattcacctgcgcgtgtcccgatgacttccag
accgttcagcttcgagacagaacactctgcatgcccatgtgctccagcacgcagttcctg
tgtggcaacaatgaaaagtgtatccccatatggtggaaatgtgatggccagaaagactgc
tctgatggttctgatgaaccagacctgtgcccacaccgcttctgccgtctggggcagttc
cagtgccgggatggcaactgcacgagcccccaggctctgtgcaatgctcgccaggattgt
gctgatggctctgatgaagaccgtgttctctgtgagcatcaccggtgtgagtccaacgag
tggcagtgcgccaacaagcgttgcatcccacagtcctggcagtgtgactcagtgaacgac
tgcctggataactcagatgaggacacttcgcactgcgccagcaggacctgcaggcccggc
cagttcaagtgtaacaatggtcgctgtatcccgcagagctggaagtgtgacgtagacaat
gattgtggagactactccgatgagcccatcgacgagtgcacgaccgctgcttacaactgt
gacaaccacacagaattcagctgcaagactaactaccgttgcatcccgcagtgggcggtg
tgcaatggttttgatgactgcagggacaacagtgatgaacaaggctgtgaatcggtgcca
tgccatccttctggggatttccggtgtgcgaatcaccactgcatccctctccgctggaag
tgtgacggcactgacgactgtggagataactcggatgaggaaaactgcgttcctcgggag
tgctcagagagcgagtttcgatgtgctgatcagcaatgcatcccctctcgatgggtctgt
gaccaagaaaatgactgtggagacaactcggatgaacgggactgtgagatgaagacctgc
catcctgaacattttcagtgtacgagtggacactgtgtgcccaaggcgttggcatgcgat
gggagggcagactgtctggatgcgtctgatgaatctgcttgtcctactcgctttcccaac
ggcacctactgcccagccgccatgttcgaatgtaaaaaccacgtgtgcatccagtcgttt
tggatatgtgatggggaaaatgactgtgtcgacggttccgatgaggagatccacctgtgc
ttcaacattccgtgtgaatcaccacagcgattccggtgtgacaacagccgctgtgtttat
ggccatcagctgtgcaatggtgtggatgactgcggagatggaagtgacgagaaagaagag
cactgtagaaaaccaacccacaaaccgtgcacagacactgaatataagtgtagcaatggg
aactgcatttcgcagcactacgtgtgtgataatgtgaatgactgcggagacctttctgat
gaaactggttgcaatctaggagataacagaacgtgtgctgaaaacatatgtgaacagaac
tgtacccagctgagcagcggaggctttatctgctcctgcagacccgggttcaaacctagt
acttcggacaaaaattcctgtcaagacatcaatgaatgtgaggagtttggcatctgcccc
cagagctgtcgaaacagcaaaggaagttatgaatgtttctgtgtcgatggcttcaagtct
atgagtacccattatggagaacggtgtgcagctgatggaagccctcctctcttgctcctg
cctgagaatgtccgaatccggaagtacaatacctcctctgagaagttctcagagtatctg
gaagaggaggagcatatccaaactattgactatgactgggatcccgagcacataggcctc
agtgttgtctattacactgtgctggcacagggctctcaattcggtgctatcaaacgtgcc
tacattcccaactttgaatctggtagtaacaatcccatacgtgaagttgacctgggcttg
aaatatttaatgcagccagatggattagccgtggactgggtcggaaggcatatttactgg
tcagatgctaagagccaacggattgaggtggctaccctcgatggaaggtaccggaagtgg
ctgatcaccacccaactggatcagccagctgccattgctgtgaatcctaagctagggctt
atgttctggactgaccagggaaaacagcccaaaatcgagtctgcctggatgaacggggaa
catcgcagcgttctggtttctgagaaccttggctggccaaacggtctttccatagattac
ctgaatgatgaccgggtctactggagcgactccaaagaagatgtcattgaagccataaaa
tatgatgggactgacaggagacttatcataaatgaagcgatgaagcccttcagtctggac
atcttcgaagacaagctatactgggtagctaaggaaaagggagaagtgtggagacaaaat
aaattcgggaaagagaacaaagagaaagtgctggtggtgaacccgtggctcactcaagtt
cgaatcttccatcaactgagatacaatcagtcagtgtccaacccttgcaagcaggtctgt
agtcacctctgcctgctgagaccaggaggctacagctgtgcctgtccccaaggctccgac
ttcgtaactggcagcactgtccagtgtgatgcagccagtgaacttcccgtcaccatgcct
cccccatgcaggtgcatgcacggaggaaattgctattttgatgagaatgaactccccaaa
tgcaagtgttccagtggctatagcggagaatactgtgaggttgggctctcgagaggcatc
cctccagggacgacaatggctgttctgttgaccttcgtgatagtcatcattgttggagct
ctggtgcttgttggactctttcactacaggaaaactggctccctcttacccactctgccc
aagctgccaagcctaagcagccttgccaaaccctctgaaaatggaaatggggtgacgttc
aggtcgggggctgatgtgaacatggacatcggtgtgtctcctttcggccctgagacaatt
attgacagatccatggcgatgaatgaacactttgtcatggaggtgggcaagcagcctgtg
atatttgaaaacccaatgtatgcagccaaggacaacacttccaaagtggccctggcagtt
caggggccatcaacaggcgcacaggtgactgtaccagaaaatgtggaaaaccagaattat
ggaaggcccatagatccttctgagatagttccagagccaaagccagcctcccctggagct
gatgaaattcagggcaaaaaatggaacatcttcaaacgaaaacccaaacagacaacgaac
tttgagaacccaatctacgcagagatggacagtgaggtaaaggatgctgtggctgtggcc
ccccctccgtctccttctctccctgccaaagcttcaaaaagaaatttgactccaggctac
actgccacagaagacacctttaaagacactgcaaatctcgttaaagaagattccgacgta
tag

KEGG   Rattus norvegicus (rat): 360715
Entry
360715            CDS       T01003                                 

Gene name
Boc
Definition
(RefSeq) BOC cell adhesion associated, oncogene regulated
  KO
K20020  brother of CDO
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    360715 (Boc)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    360715 (Boc)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 ISET-FN3_linker V-set Ig_4 Ig_5 C2-set_2 C1-set Izumo-Ig Y_Y_Y
Other DBs
NCBI-GeneID: 360715
NCBI-ProteinID: XP_006221199
RGD: 1304550
Ensembl: ENSRNOG00000002041
LinkDB
Position
11q21
AA seq 1110 aa
MVTCRGEQPMLTLLWFLLAIAGCLADLNEVPQVTVQPMSTVQKLGGTVILGCVVEPPWVN
VTWRFNGKELNGSDDALGVLITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLA
NLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGNL
QIVNASQEDEGTYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPLEAQTVIVTKG
QSLILECVASGIPPPRVTWAKDGSSIAAYNKTRFLLSNLLIDTTSEEDSGTYRCMASNGV
GDPGAAVILYNVQVFEPPEVTVELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNAVPLSS
NQRLRLSRKALRVVSVRPEDEGVYQCMAENAVGSAHAVVQLRTARPDTTLRPGRDTKPIA
ATPPMPPSRPNRPDQMLREQPGLVKPPTSVQPTSLKCLGEEQVAPAEAPVILSSPRTSKT
DSYELVWRPRHEGSSRAPILYYVVKHRKQVTNSSDDWIISGIPANQHHLTLTRLDPGSLY
EVEMAAYNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGASLQSSSQPDHGRLSP
PEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIPPSRLS
VEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITFTDAVN
ETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISHLQPETS
YDIKMQCFNEGGESEFSNVMICETKARKFSGQPGRPPPLTLAPPQPPPLEAMERPMGTGA
MVARASDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALLSSSCQYT
MVPLGGLPGHQANGQPYLSGIGGRACVSRLHGSRGYPAATVGCPGRKLQQHCPGELAQQR
EDSNSLLRQPIVSNGYDLQNQQVARGTKSGSEEGSFLYTLPDDSTHQLLQPQDCCHLQKQ
PVTTCQTAVRRAPEGPGLEASWDPQYHSGPRCCLGLVPVEEVDSSDSCQVGGGDCCPQHP
SGTYTGQELGVRLSPSPSVHVSFETPPPTI
NT seq 3333 nt   +upstreamnt  +downstreamnt
atggtaacgtgccgaggagagcagcctatgctcacactgctttggttcctcttagccata
gcaggctgcctggctgatttgaatgaggttcctcaggtcacggtccagcccatgtccact
gtccagaagctcggaggaactgtgatcctgggctgtgtggtggagccaccatgggtgaac
gtgacttggcgcttcaacgggaaggagctaaatggctcggatgatgctctaggtgtcctc
atcacccgtgggaccctggtcattgctgccctcaacaaccacactgtgggacgataccag
tgtgtggctcggatgcctgcgggagctgtggccagtgtgccagccacggtgacactagcc
aatctccaggactttaagttagatgtgcagcatgtgattgaagtagatgaggggaacaca
gctgtcattgcctgccacctgcctgagagtcacccaaaagcccaggtccggtacagcgtc
aaacaggagtggctggaggcctctagagacaactacctgatcatgccatcggggaatctc
caaattgtcaatgccagccaggaggatgagggcacgtacaagtgtgctgcctacaaccca
gtgacccaggaagtgaaaacctctggctccagtgacaggctgcgcgtgcgccggtccacc
gctgaggctgcccgcatcatctacccactagaagctcagactgtcattgtcaccaaaggc
cagagtctcatactggagtgtgtggccagtggaatcccgccacctcgagtcacgtgggcc
aaggatgggtccagcattgctgcctacaacaagactcgcttcctgctgagtaacttgctc
attgacaccaccagtgaggaggactcaggcacctaccgctgtatggccagcaatggggtt
ggagatcccggtgcagctgtcattctctacaacgtccaggtgtttgaaccccctgaggtc
accgtggagctatcccagctcgtcatcccatggggccagagtgcaaagctcacctgtgag
gttcgaggaaaccccccaccctctgtactgtggttgaggaatgctgtgcctctcagctcc
aaccagcgcctccggctgtctcgcaaagcccttcgtgtggtcagtgtcaggcctgaggat
gaaggcgtgtaccagtgcatggctgagaatgctgttgggagtgcccatgctgtggttcaa
ctgaggactgcccggccagacacaaccctgagacccgggagggatactaagccgattgct
gccacacctcccatgccgccctcccgacccaacagacctgaccagatgcttcgggaacaa
ccggggcttgttaagcccccaacatcagtacagcctacttccctaaagtgcctgggagag
gagcaggtagcccctgcggaggcacccgtcatcctcagctcaccccggacctccaagacg
gattcatacgagctggtgtggcggcctcgccatgagggcagcagccgggcacccatcctg
tactacgtagtgaagcatcgtaagcaggtcacaaactcctctgatgactggatcatttct
ggcattccagccaaccagcaccaccttaccctgaccaggcttgatcctggaagcttgtac
gaagtggagatggcagcctacaactgtgctggcgagggtcagacggccatggtcaccttc
cgaacaggacggcggcccaaacctgagatcgtggccagcaaggagcagcagatccagaga
gatgaccctggtgccagtctccagagtagcagccagcctgaccacggccgcctctctccc
ccagaagctccagacagacccaccatctccacagcttctgagacctcagtgtatgtaacc
tggattccccgagggaatggcggcttcccaattcagtctttccgtgtggagtacaagaag
ctaaaaaaagtgggagattggatactggccaccagtgccatacctccctcgaggctctct
gtggagatcacaggcctggagaaaggtatttcttacaagttccgagtccgtgctttgaac
atgctaggggaaagtgagcccagtgctccctcccggccttatgtggtatcaggctacagt
ggccgtgtgtatgagagacccgtggcaggaccttacatcactttcaccgatgcagtcaat
gagaccaccattatgctcaagtggatgtatatccctgccagcaacaacaacaccccaatc
catggcttctatatctactaccgacccacagatagtgacaacgacagtgattacaagaaa
gacatggtggaaggggacaggtactggcactccatcagccacctgcagccagagacctcc
tatgacattaagatgcaatgcttcaacgaaggaggggagagcgagttcagcaacgtcatg
atctgtgagaccaaagctcggaaattttctggtcagcctggaagacccccacccttaact
ctggctccaccacaacctccgcccctagaagccatggagcggccgatgggcactggagcc
atggtggcccgggccagcgacctgccctatctgattgtcggggtcgttctgggctctatc
gtcctcatcatcgtcaccttcatccccttctgcctatggagggcctggtctaagcagaag
catacaacagatctgggttttcctcggagtgccctcctgtcttcttcctgccagtacaca
atggtgccactgggaggacttccaggtcaccaagccaatggccagccctacctcagtggt
attggtggacgggcctgtgtcagcagactacacggaagcaggggctaccctgctgctaca
gtgggctgcccaggcaggaagcttcaacagcactgcccaggggagcttgcacagcagcgg
gaagactccaacagcctactgaggcagcccattgttagcaatggatatgacctccagaac
cagcaggttgccagaggtaccaagtctggttcagaagaaggttctttcttatacacgctg
ccagatgactcaactcaccagctgctccaacctcaagattgctgtcacctccagaagcaa
cctgtcaccacgtgccagacagcagtgagaagagcaccggaaggtcctgggctagaagct
tcatgggaccctcaatatcattcaggaccccggtgttgtttaggtcttgtaccagttgaa
gaggtagacagttctgactcctgccaagtgggtggaggagactgctgtccccagcaccct
tcagggacctacacaggacaagaacttggggtgcgcctctctcccagcccatcagttcat
gtgtcctttgaaacaccacctcccacaatttag

KEGG   Rattus norvegicus (rat): 50938
Entry
50938             CDS       T01003                                 

Gene name
Cdon, Cdo
Definition
(RefSeq) cell adhesion associated, oncogene regulated
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    50938 (Cdon)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_4 Ig_6 Ig_5 Pur_ac_phosph_N Izumo-Ig Tissue_fac
Other DBs
NCBI-GeneID: 50938
NCBI-ProteinID: NP_059054
RGD: 708433
Ensembl: ENSRNOG00000011789
UniProt: O35158
LinkDB
Position
8q21
AA seq 1256 aa
MHPDLGPLWKLLYVLVILCSSVSSDLATYFISEPLSAVQKLGRPVVLHCSAKPVTARISW
LHNGKRLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSVGAVVSGPATVSADALADF
DSSTMHVITAEKKNTGFIGCRVPESNPKAEVRYKIRGKWLMYSTGNYIILPSGNLQILNV
SSKDKGSYKCAAYNPVTSELKVEPAGRKLLVSRPSSDGFHILHPALSQALAVLPHSPVTL
ECVVSGVPASQVYWLKDGQDCLSGSNWRRLYSHLATASIDPADSGNYSCVVGNNSSGDVK
HVTYTVNVLEHASISKGLHDQKVSLGATVRFTCEVHGNPAPNRTWFHNAQPIRPSSRHLT
EGSVLKITGVIMEDSGLYQCMADNGIGFMQSTGRLQIEQDSGQRPVIVTAPANVEVTDGD
FVTLSCNATGEPVPVIHWYGRHGLITSHPSQVLRSKSRKSHLFRPGDLDPEPVYLIMSQA
GSSSLSIQAVTREHAGKYTCEAVNKHGSTQSEAFLTVVPFETNTKAEPVTPSEASQNDER
DPRDGSESGLLNLFPVKVHSGGVELPAEKNASVPDAPNILSPPQTHMPDTYTLVWRTGRD
GGMPINAYFVKYRKLDDGSGAVGSWHTVRVPGSESELHLTELEPSSLYEVLMVARSAVGE
GQPAMLTFRTSKEKMASSKNTQASFPPVGIPKRPVTSEASNSNFGVVLTDSSRHSGVPEA
PDRPTISMASETSVYVTWIPRANGGSPITAFKVEYKRMKSSDWLVAAEDIPPSKLSVEVR
SLEPGSIYKFRVIVINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQI
MLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIK
MQCFNEGGESEFSNVMICETKVKRVPGASEYPMKELSTPPSSSGNGGNVGPATSPARSSD
MLYLIVGCVLGVMVLILLVFIALCLWKSRQQSAIQKYDPPGYLYQGSEINGQMVEYTTLS
GTARINGSVHGGFLSKGSLSNGCSHLHHKGPNGVNGILNGTINGGLYSAHTSSLTRTCVE
FEHPHHLVNGGAVYTAVPQMDPLECINCRNCRNNNRCFTKTNSPLPVVPVVASYPQDGLE
MKPLGVMKFPVCPVSTVPDGGQIPEECLKDSVAPAPTQRTCRQDNTSDINSDSTEDTAEF
NRGDSSGHSEAEDKVFSWSPLILSPVLEDCSEKTAWSPPGPPLDGLSVVLQQAQET
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgcatccagacctcggacccttatggaaactgctgtatgttcttgtgattctgtgttct
tctgtgagctcagacttggcaacttattttatttctgagccactctctgctgtccagaag
cttggcagacccgtggtcctacattgttctgctaaacctgttactgcccgaatctcatgg
ttgcataatggaaaacgattggacagaaacacagaacagataaagatccaccgggggact
ttgaccattctgtctctcaacccttccctttctggttgctaccagtgtgtggccaacaac
agtgttggggctgttgtcagtggccctgccacagtgtccgctgacgccctggctgatttc
gattcatcaacaatgcatgttattactgcagagaagaaaaacacgggtttcattggctgc
agggtacctgagagtaaccccaaagctgaggtgcgctacaagatccggggaaagtggctg
atgtattccacagggaactacataatccttccctcaggaaatcttcagattttgaatgta
tcctcgaaggataagggatcgtacaagtgtgctgcctataatcctgtcaccagtgaactg
aaagttgaacccgctggccggaagctccttgtgagtcgtccttcctcggatggttttcac
attcttcaccctgctctttctcaggcattagctgtccttccgcacagccctgttaccttg
gagtgtgtagtgagtggggtccccgcctcacaagtgtattggctgaaggacgggcaggat
tgcctgtcaggaagcaactggagaaggctgtactctcacctggccacagctagcatcgac
ccagcggattccgggaactattcctgtgtggtgggcaacaacagttccggagatgttaaa
cacgtcacttacacagtcaacgtactggagcacgcttcaatttctaaagggctgcacgat
cagaaggtgtccctgggggccaccgtacgttttacctgcgaagttcacgggaacccagcc
cccaaccgcacctggtttcataacgcacagcccatccgcccctcctcacggcatctgacg
gaaggaagtgttctgaagatcaccggggtcatcatggaggattctgggttgtatcagtgc
atggcagacaatgggattggatttatgcaatctactggaagacttcaaattgaacaagac
agtggacagaggcctgtcatagtcaccgccccagcaaacgtagaggtgacggacggagac
ttcgtgactttgtcttgcaatgccacaggagagcctgtcccggtcattcattggtacggc
cgccatggattgataaccagccatccatctcaggtccttaggtccaaatctcgaaagtcc
cacctcttccgacctggggacctggacccggagcctgtctacctcatcatgtcccaagcg
ggctcgagctctctgtccatccaggcagtgactcgggagcatgctgggaaatacacttgc
gaagctgtgaacaaacatggcagcacacagtcagaagcgttcctcacagtcgttcctttt
gaaacaaacacaaaggcagagccagtcacaccctccgaagcttctcagaacgatgaacga
gacccacgagacggttcagagtccggcttgctgaacttgtttccagtgaaggtgcattcc
ggtggagtggaattgccagcagagaaaaatgcctctgtccccgatgctcctaacatactg
agccccccacagacccacatgccagacacatacaccctggtgtggaggacggggagggat
ggcggaatgcccatcaacgcctatttcgtgaagtaccgaaagctggacgacggcagtggt
gcggtaggcagctggcacacggttcgcgtcccagggagtgagagcgagctgcatctaacc
gaactggagccttcaagcctttatgaagttttgatggtggccagaagtgcagtcggcgaa
ggacagcctgccatgcttaccttccggaccagcaaagaaaagatggcatcatcaaaaaac
acccaggcgtcctttccacctgtgggcatccctaagcggcctgtaacttcggaggcttcc
aacagcaattttggagttgtgcttacggattcctctaggcatagtggagtcccagaggca
ccagatcgacctactatctcgatggcatcggagacctcagtctatgtcacctggattccc
cgtgcaaatggcggctctcccatcactgccttcaaggtggaatataagcggatgaaaagt
agtgactggctggtggctgctgaagacatccctccttccaaactctctgtggaagtccgg
agtttagagccaggttcgatatacaaatttagggtcattgttatcaaccattacggtgag
agttttcggagctcggcgtcccgtccctaccaggtggctggtttcccaaatcgcttttcc
aatcgccccataactggacctcacatcgcatacacagaggctgtcagcgatactcagatc
atgctaaaatggacgtatattccatcaagtaacaataacactcccattcaaggattctat
atctattaccggccaacagacagtgacaatgacagtgattacaagagggatgttgtggaa
ggttcaaagcagtggcacaccattggtcacctgcagccagagacctcctatgacattaag
atgcagtgctttaatgaaggaggagagagcgagttcagcaacgtgatgatctgcgagact
aaagtgaaacgagttcccggagcatcggagtatcccatgaaagagttgagcactcctccc
agttcttcagggaacggagggaacgtggggcctgcaaccagccctgccaggagcagcgac
atgctgtacctcatcgtcggctgtgtgcttggggttatggtcctcattcttctggtcttc
attgcactgtgtctgtggaagagtcgccaacagagtgccatacagaaatatgatcctcca
ggatatctctaccaggggtcagagattaatgggcagatggtagagtataccactctctca
ggaacagcccggatcaatgggagtgttcacggaggcttcctcagcaaaggcagtctcagc
aatggctgctctcacctccaccacaaaggccccaacggagtcaatgggatcctgaatgga
accataaatggggggctttattctgcacacaccagctccctaaccaggacgtgtgtggag
ttcgaacatcctcaccatctagtgaacggtggagcagtgtacacggctgtccctcagatg
gacccactggaatgcattaattgtcggaattgccggaacaacaataggtgtttcaccaaa
accaacagtccccttcctgtggtcccagtggtagcctcttatcctcaggatggactggaa
atgaagcccctcggtgtcatgaagttcccagtgtgtccagtttccacagttcctgatggt
ggccagatacctgaggagtgcctcaaggacagcgtggcaccagcacctacccagcgtaca
tgccgccaggacaacacaagcgacatcaattctgattccacagaagacacagcagagttc
aacagaggagacagcagcggtcattcagaagcagaggacaaagttttcagttggagtcct
cttattttatcacctgtcttggaggactgcagtgagaagacagcgtggtctcctcctggc
ccccctctagacgggctgtcagtggtccttcagcaagcccaagagacctga

KEGG   Rattus norvegicus (rat): 683470
Entry
683470            CDS       T01003                                 

Gene name
Gas1
Definition
(RefSeq) growth arrest-specific 1
  KO
K06232  growth arrest-specific 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    683470 (Gas1)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 683470
NCBI-ProteinID: XP_001066058
RGD: 1586820
Ensembl: ENSRNOG00000050485
UniProt: M0RBH9
LinkDB
Position
17p14
AA seq 383 aa
MDEDAHARSARNSDKLFQRPRGRHPSLVSAPHRVRRPLLPAMLAALLGGGGARSGSLPGA
LLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPDCSYAYSQYAEACAPVLAQRG
GADAPGPAGAFPSSAASFSPRWRCPSHCISALIQLNHTRRGPALEDCDCAQDEHCRSTKR
AIEPCLPRTSSVGPGAGAGSVMGCTEARRRCDRDSRCNLALGRYLAYCGKLFNGLRCTDE
CRAVIEDMLAVPKAALLNDCVCDGLERPICESVKENMARLCFGPDASNGPGSSGSDGGLD
DYYDEEYDDEQRAGAAGGEQPLDDDDGLARPGGGAAGAGGRGDLPHGPGRRSSSSGSGGH
WATRSSWTPFACFLLLLLLGSHL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatgaggacgcccatgccagaagtgcgcggaactcggacaaacttttccagcggccc
cgcggccgccacccgagcctcgtttccgctccgcaccgcgtccggcggccgctgctgccc
gcgatgctagccgcactgctgggcggcggcggagcccgctcggggagcttgccgggcgcc
ttgctgtgcctgatggcgctgctgcagttgctgggctcggcgccgcggggctcggggctg
gcgcacggccgccgcctcatctgctggcaggcgctgctgcagtgtcagggagagccggac
tgcagctacgcctacagccagtacgccgaggcgtgtgcgccggtgctcgcacagcgcggc
ggagctgatgctcctgggcccgccggcgccttcccctcctcggccgcgtccttctcgccg
cgctggcgctgcccgagccactgcatctcggcgctcatccagctcaaccacacgcgccgc
gggcccgcgctggaggactgcgactgcgcgcaggacgaacactgcaggtccaccaagcgc
gccatcgagccctgtctgccgcgcaccagcagcgtgggcccgggcgcgggagcgggctcg
gtcatgggctgcactgaggcccggcggcgctgcgaccgggacagccgctgcaacctggca
ctcggccgctatctagcctactgcggcaagcttttcaacggtctccgctgcaccgacgag
tgccgcgcggtcatcgaggacatgctggcggtgcccaaggcggcgctgctcaacgactgt
gtgtgcgatgggctggagaggcccatctgcgagtcggtcaaggagaacatggcccgcctg
tgcttcggcccagatgcgagcaacggtccgggcagcagcggctcggacgggggcctagac
gactactacgacgaagaatatgatgacgagcagcgcgctggggccgcgggcggcgagcag
cccctggacgacgacgacggccttgcgcgcccgggcggcggcgctgctggggcaggcgga
cgcggggacttgccccacgggccggggcgcaggagcagcagcagcggcagtggaggccac
tgggcgacccgaagctcctggaccccgtttgcctgttttctgctgctcctgctgcttggg
tcccacttgtag

DBGET integrated database retrieval system