KEGG   Rattus norvegicus (rat): 293047
Entry
293047            CDS       T01003                                 

Gene name
Kif7
Definition
(RefSeq) kinesin family member 7
  KO
K18806  kinesin family member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    293047 (Kif7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    293047 (Kif7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    293047 (Kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    293047 (Kif7)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     293047 (Kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 293047
NCBI-ProteinID: XP_001065361
RGD: 1310310
Ensembl: ENSRNOG00000026857
UniProt: D4A9P0
LinkDB
Position
1q31
AA seq 1341 aa
MGLEAQKLSGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPERGRITLGRDRHFGFHVV
LGEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLELYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRAPTRLPRPGA
GHLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERVPEEQAAGARGPPRHRSETRIIHRGRRVLCPGVGSAAVAPGLGTECARCRARTSAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESAPADDQAAQGTSGR
KGDEGAQQLLILQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
AQPGWGAPGLLQGLSPGSFVPRPHTAPLGGAHTHMTGTMPRTCLPGEEVSSEQQVANGKE
AKAELLAQVDKLGSASSTTSEEEEEEEEEPPRRTLHLRRNGISNWSQRAGVRPGSPPDRK
GPEVCPEEPAAAIPAPQAVGGSKAPGQTRQAPAAMASEWRLAQAQQKIRELAINIRMKEE
LIGELVRTGKAAQALNRQHSQRIRELEQEAERVRGELCEGQRQLRELEGREPQDASERSR
LQEFRKRVAAAQSQVQVLREKKQATERLVSLSAQSETRLQELERNVQLMRRQQGQLQRRL
REETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRNRRSGSNGSVVSL
EQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELRKREVILAKKEALMQEKTGLESKRMR
SSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSALNQQQIRGEIDTLRQEKDSLLKQRL
EIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQCEM
NLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEVAL
ERQRLEMDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARIQALEKELGRHMW
INQELKQKLSAGNTAGQSRGCERRSHCLENRQGLGNEDGPHVAAQEPLWPSSLLEGAPRV
WDESRDLVHAPLPLTWKRSSLCSEQGSSEEPRARETTEPPVGRVLPMGEVSLSWNFGPLP
KPRWEPRRTSPGMIDVRKNPL
NT seq 4026 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaagctgtcgggggctgaggaggccccagtgagggtggccctt
cgagttcgccccttgctgcccaaggagctgctccatggtcatcagagttgcctgcaggtg
gagcctgagcgtggtcgaatcaccctgggtcgtgaccgccattttggattccatgtggta
ctgggagaggacgccgggcaagaggctgtgtaccaggcttgcgtgcagcccctcctcgag
gctttctttgagggcttcaatgccaccgtctttgcctatggtcaaacaggctctgggaag
acgtataccatgggggaggccagcgtggcctccctgcatgaagatgagcaaggtattatc
ccaagggccatggctgaggccttcaagctcatcgatgagaatgacctgctggactgcctg
gtacacgtatcctacctggaactgtacaaggaagagttccgagatctgctcgaagtgggc
actgccagccgggacatccagcttcgggaagatgatcggggaaatgttgtgctctgtggg
gtgaaagaagtggacgtggaaggcctggacgaggtgctgagcctcctggagatgggcaac
gctgcgcggcacacaggagccacacacttcaaccgcctctccagccgctcgcacacagtc
ttcactgtgaccctggagcagagaggacgggctcctacccgcttgcctcgacctggcgct
ggccacctgctggtctctaaattccacttcgtggacctggcaggctctgagagggttctg
aagaccggcagcaccggcgaacggctcaaagagagcatccagattaacagtaccctgctg
gccctgggaaatgtcattagtgctctgggagacccccagcgccgaggcagccacatccct
taccgtgactccaagatcacccggatcctcaaagactctctgggagggaatgccaagaca
gtgatgatcgcctgcgtcagcccctcctcctccgacttcgatgaaacccttaacacccta
aactacgccagccgtgcccagaacatccgcaatcgtgccacagtcaactggcgtccagaa
gccgagcgtgtccctgaggaacaggcggcgggtgcgcgcgggccgccgcgacaccgctcg
gagacgcgcatcatccaccgtggccggcgcgtgctctgcccaggggtgggctccgcggca
gtcgctccggggctgggcactgagtgcgcgcgctgccgggcccgcaccagcgccgcctac
agcctcctgcgagagctgcaggccgagcctgggctaccgggcgctgctgcccgcaaagtg
cgggactggctgtgcgcggtggagggtgaacgcagcgccctgagctctgcctctgggccc
gacagcggcatcgaaagcgctccagctgatgaccaggcggcacaggggaccagcgggaga
aagggagatgagggggcccagcagctgttgatcctgcagagccaagtggcccggctagag
gaggagaatcgagacttcctggcggctttggaggacgccatggagcagtacaaactgcag
agcgaccgcctgcgggagcagcaggaagagatggtggaacttcggctacgcctagagctg
gcacagcctggctggggagcaccggggctcctgcagggcctgtcaccaggatccttcgta
ccccggcctcacacagcccccctggggggtgcccacactcacatgacgggcacgatgccc
cggacatgtctccctggagaagaagttagttctgagcagcaggtggcgaatggcaaggaa
gccaaggcggagttgttggcccaggtggacaagctgggcagtgcctcctccactacatca
gaggaggaagaggaggaggaggaggagccacccaggaggaccttacacctgcgcaggaat
ggaatcagcaactggagtcagagggcaggggtgcgtcctgggagcccacctgacaggaag
ggcccagaggtctgcccagaagagccagctgctgccatcccagcaccacaagcagtcggt
ggtagcaaggccccgggtcagacccgccaggccccagctgccatggcctccgagtggcga
ctggcccaggcccagcagaagatccgggaactggccatcaacatccgcatgaaggaggag
ctcattggtgagctggtccgcacagggaaggcggcccaggccctgaaccgccagcacagc
caacgcattcgggagctggagcaggaggccgagcgagtgcggggggagctgtgtgaaggg
cagaggcagcttcgtgagctggagggcagggagcctcaggatgccagcgagaggtccagg
cttcaggaattccgtaagagagtggctgcagcccaaagccaggtgcaggtactgagggag
aagaagcaggcaacagagcggctggtgtcactgtcggctcaaagtgagactcggctacag
gagctggagaggaatgtgcagctcatgcggcgacagcaggggcagctgcagaggcggctc
cgagaggagacagagcagaagcggcgtctagagacggagatgaacaagagacagcatcgt
gtcaaggagctggagctgaagcatgagcaacagcagaagatcctgaaaatcaagacagaa
gagattgcagccttccagaggaatagacgcagtggcagcaatggctctgtggtgagcctg
gagcagcagcagaaaattgaggagcagaagaagtggctggaccaggagatggaaaaggtg
ctacagcagcggcgggcgctggaggagttgggagaggagctccgcaagcgggaggtcatt
ctggctaagaaggaggccctgatgcaggagaagactggactagagagcaagcgcatgagg
tctagccaggccctaaatgaagacatcgtgcgcgtgtccagccgtctagaacacctggag
aaggagctatctgagaagagtggtcagctgcggcaaggcagcgccctgaaccaacagcag
atccgaggggagatagacaccctgcgccaggagaaggactcgctgctgaagcaacgcctg
gagatcgatagcaagctgaggcagggaagcctgctgtcacctgaggaggagaggacactg
ttccagctggatgaagccatagaggccctggatgctgccatcgagtacaagaatgaggct
attacatgccgccagcgggtgctgcgggcctcggcctccttgctgtcccagtgtgagatg
aatctcatggccaagctcagctacctttcttcctcagagaccagagccctgctgtgcaag
tattttgacaaggtggtgactctcagagaggagcaacaccagcaacagattgccttctcg
gagctggagatgcagctggaggagcagcagcggctggtgtattggctggaggtggccctg
gagcggcagcgcctggagatggaccgccagctgacgctgcagcagaaggagcatgagcag
aacgtgcagctgctccttcagcagggtcgagaccaccttggcgaggggttagcagacagc
aagaggcaatatgaggcccggattcaagctctggagaaggaactaggtcgacacatgtgg
ataaaccaggagctcaaacaaaagctcagtgcgggaaacactgcaggccagagccggggt
tgtgagaggagaagccactgcctggaaaatagacaaggccttggaaatgaagatgggccc
catgtagcagctcaggaacctctctggccatcttcccttctggaaggggcaccccgtgtg
tgggatgagtcccgggacttggtccacgccccgctacctctgacatggaaacgctcaagc
ttgtgcagtgaacagggctcctctgaggagcctagggcacgggaaacaacagaaccccca
gtagggcgggtgctacccatgggtgaagtgagcctctcctggaactttggacccttgcct
aagcctcggtgggaaccccgaagaaccagcccagggatgatcgacgtcaggaaaaacccc
ttgtag

DBGET integrated database retrieval system