KEGG   Rattus norvegicus (rat): 293181Help
Entry
293181            CDS       T01003                                 

Gene name
Galnt18, Galntl4, RGD1309623
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 18
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    293181 (Galnt18)
   00514 Other types of O-glycan biosynthesis
    293181 (Galnt18)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    293181 (Galnt18)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     293181 (Galnt18)
Glycosyltransferases [BR:rno01003]
 O-Glycan biosynthesis
  Mucin-type
   293181 (Galnt18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 293181
NCBI-ProteinID: NP_001073353
RGD: 1309623
Ensembl: ENSRNOG00000017021
UniProt: A1A5P1
LinkDB All DBs
Position
1q33
AA seq 607 aa AA seqDB search
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPSHLLKEIILVDDNSSNEELKEKLTEYVDKVNGQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFEEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTD
LCFDQGPDTENVPIVYICHGMTPQNVYYTSSQQIHVGVLSPTIDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGSIQNRKSKRCLELQENSDMEFGFQLVLQKCSGQHWTITN
VLRSLVS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtaccaggaagaccaaaactttggtgtccacttgcgtgatcctgagcggcatg
accaacatcatatgcctgctgtacgtgggctgggtcaccaactacattgccagcgtgtat
gtgcgggggcaggagccagcgcccgacaagaaactggaggaagataaaggggacaccctg
aaaattatcgagcggctggaccacttggagaatgtcatcaaacagcatatccaagaggct
cctgccaagcctgaggaggcagaggctgagcccttcacggactcctccctgtttgcacac
tggggtcaggagctcagccccgaaggccggcgtgtggccctgaagcagttccagtactat
ggctacaacgcctacctcagtgaccggctacccctcgaccggcccctgccagacctcaga
cccagtgggtgccgcaacctctcattccctgacagcctcccagaggtgagcatcgtgttc
atcttcgtcaatgaggcactgtctgtgctgctgcgttctatccactcagccatggagcgc
acaccatcacacctgctcaaggagatcatcctggtggacgacaacagcagcaacgaggag
ctcaaagaaaagctgactgaatatgtggacaaagtgaacgggcagaaaccaggcttcatc
aaagttgtgcggcacagcaagcaggaaggcctcatccgctccagggtcagcggctggagg
gcagccacagcccctgtggtggcactgttcgatgcccatgtggagttcaatgtgggctgg
gcggaaccagtcctcacccgaatcaaggaaaaccggaaacggatcatctcaccatctttt
gataacatcaaatatgacaactttgagatagaagaatacccactggctgcccaaggcttc
gactgggagctgtggtgccgctacctgaacccacccaaggcctggtggaagctggagaac
tccacagccccaatcaggagccccgccctcattggctgtttcattgtggaccggcagtac
ttcgaggagattggcctgttggacgaaggcatggaggtctatggaggggagaatgtggag
cttgggatcagggtatggcagtgtggcgggagtgtggaggtcctgccctgctctcggatt
gcccacatcgagcgagcccacaagccctacacagaggacctcactgcccacgtgcggaga
aatgccctcagggtagctgaagtctggatggatgaattcaaaagtcatgtctacatggca
tggaacataccacaagaggactcagggattgacattggggacatcacagcacggaaggct
ctgaggaagcagctgcagtgtaagactttcaggtggtacctggtcagtgtgtacccagag
atgaggatgtactctgacatcatcgcctatggagtgctgcagaattccctgaagactgat
ttgtgttttgatcagggcccagatacagagaacgtccccatcgtgtacatatgccatggg
atgactccccagaatgtgtactacacgagcagccagcagatccacgtgggtgtcctgagt
cccactattgatgacgatgacaaccggtgtctggtggacgtcaacagccggccacgactc
atcgagtgcagctacgccaaggccaagaggatgaagctgcactggcagttctcccaggga
ggctccatccagaaccgcaagtccaagcgctgcctggagctgcaagaaaacagcgacatg
gagtttggtttccagctggtgctgcagaagtgctcgggacaacactggactatcaccaat
gtcctgaggagcctggtgtcctga

DBGET integrated database retrieval system