KEGG   Rattus norvegicus (rat): 363140
Entry
363140            CDS       T01003                                 

Gene name
Rassf1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05219  Bladder cancer
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    363140 (Rassf1)
   04390 Hippo signaling pathway
    363140 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    363140 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363140 (Rassf1)
   05206 MicroRNAs in cancer
    363140 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    363140 (Rassf1)
   05223 Non-small cell lung cancer
    363140 (Rassf1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH DUF5111
Other DBs
NCBI-GeneID: 363140
NCBI-ProteinID: NP_001007755
RGD: 1359383
Ensembl: ENSRNOG00000021548
UniProt: Q68FW0
LinkDB
Position
8q32
AA seq 270 aa
MGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEAVERETPDL
SQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARR
GTGRSSAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFMVVDDPRKFALFERTER
HGQIYFRKLSDEEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQR
EEEEHLRQILQKYSRCRQKIQEALHACPLG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcgaggctgaaacaccttccttcgaaatgacctggagcagcacgacaagtagtggc
tactgcagccaggaggactcggactcagagctcgagcagtacttcacggcgcgtacctcg
ctggtccgcaggccgcgccgggaccaggatgaggctgtggagcgggagacacctgatctt
tcccaagctgagactgagcagaaaatcaaggattacaatggccagatcaacagcaacctc
ttcatgagcctgaataaggatggctcctacaccggcttcatcaaggttcagctgaaactg
gtacgccctgtttcagtgccttccagcaagaaaccgccttccttgcaggatgcccggagg
ggcacggggcggagctcagctgtgaagcgccgcacctctttttacttgcctaaggatgct
gttaagcatctgcacgttctgtcacgaacacgcgcgcgtgaggtcattgaggccctgctt
cgaaaattcatggtagtagatgatcctcgcaagtttgcactctttgaacgaactgaacgc
catggccaaatatacttccggaaactgtcagatgaggagcagcccttgaagctacggctt
cttgcagggcccagtgaaaaagccctgagctttgtcctgaaggagaatgactctggggag
gtgaattgggatgccttcagcatgcctgagctgcacaatttcttgcgcatcctgcagcgt
gaagaagaggaacaccttcgccagatcctgcagaagtattctcggtgtcgccagaagatc
caggaggccttgcacgcctgtcctttggggtga

DBGET integrated database retrieval system