KEGG   Rattus norvegicus (rat): 406169
Entry
406169            CDS       T01003                                 

Gene name
Atf6b, Crebl1
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    406169 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    406169 (Atf6b)
   04022 cGMP-PKG signaling pathway
    406169 (Atf6b)
   04151 PI3K-Akt signaling pathway
    406169 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    406169 (Atf6b)
   04915 Estrogen signaling pathway
    406169 (Atf6b)
   04926 Relaxin signaling pathway
    406169 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    406169 (Atf6b)
   04918 Thyroid hormone synthesis
    406169 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    406169 (Atf6b)
   04925 Aldosterone synthesis and secretion
    406169 (Atf6b)
   04927 Cortisol synthesis and secretion
    406169 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    406169 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    406169 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    406169 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    406169 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    406169 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    406169 (Atf6b)
   05031 Amphetamine addiction
    406169 (Atf6b)
   05034 Alcoholism
    406169 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    406169 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    406169 (Atf6b)
   05161 Hepatitis B
    406169 (Atf6b)
   05163 Human cytomegalovirus infection
    406169 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    406169 (Atf6b)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    406169 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 406169
NCBI-ProteinID: NP_001002809
RGD: 1303317
Ensembl: ENSRNOG00000000431
Vega: OTTRNOG00000001701
UniProt: Q4G097
LinkDB
Position
20p12
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTQLFRCVEQDVPFDSSSL
DVGMDVIPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQVPRVGEVLQ
VKMESLAPPLCLLGDDPAFPFETVQITVGSASDDLADIQTKLEPASPSSSVNSEASLLSA
DSPSQALIGEEVLEVKTESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGKAPAPRKPP
LQPKPVVLTTVPVPPRAGPASTAVLLQPLVQQPAVSPVVLIQGAIRAQPEGPAPAAPRPE
RKSIVPAPMPGNACPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPAP
VSRMSREGPRPQRHLLGFSEPGPAHGIEPLQEAAKGPEEQQPSPAGKPSFRNLTAFPSGA
KELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGHQRGRRKIPHRAQERQKS
QLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPGRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPAGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPSPGNTTGGPLPGSAASPARQASRQPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagatcgccgacccgacgcgcttcttcaccgacaac
ctgctgagtccggaggactgggacagcaccttgtacagtggcctggatgaagtggccgag
gagcagacgcagttgtttcgttgcgtggagcaggatgtcccgtttgacagcagctctctg
gatgtggggatggatgtcatcccccctgagcccccttgggaccctctacccatcttccca
gatcttcaggtgaagtctgagccgtcctctccctgctcctcttcctccctcagctcagaa
tcctcacatctttccacagagccctccagccaggttcctagagtaggggaggtgctgcag
gtaaagatggagtccctggcacccccgctctgcctgctgggagatgatccagcgttcccc
tttgaaacagtccagatcactgtgggctctgcctctgatgatctcgcagatatccagacc
aagctagaacccgcctctccgtcttcctctgtcaactccgaggcctccttgctgtcagca
gactctcccagccaggctcttataggagaggaggttctggaagtgaagacagagtctccg
tcccctccagggtgcctcctctgggatgtcccagcctcttcacttggagctgtccagatc
agcatgggtccgtcccctgatagttcctcagggaaagctcctgcccctcggaagcctcca
ctgcagcccaagcctgtggtgctaaccacagttccggtgccacctagagctgggcctgcc
agcactgctgtccttctgcagcccctggtccagcagcccgcagtatccccggtggttctc
atccaaggtgctatccgagcccagcctgaagggccagctccggcagcccctcggcctgag
aggaagagcattgtcccagcccctatgccggggaacgcctgcccgcctgaagtggacgcg
aagctgctaaagcgccagcagcggatgatcaagaaccgggagtcagcctgccagtcccgc
cgcaagaagaaggagtacctgcaaggcctggaggcccggctgcaggccgtgctggccgac
aaccagcagctgcgccgggagaatgctgccctccggcggcggctggaggccctactggca
gagaacagcgagctcaagctggggtctggaaacaggaaggttgtctgcatcatggtcttc
cttctcttcattgccttcaactttgggcctgtcagcatcagcgagccacctccagctccc
gtctctcggatgagcagggagggaccccgaccccagaggcacctgctggggttctcagaa
ccagggccagctcacggcatcgaacccctccaggaagctgccaagggccctgaggagcag
cagcccagccctgcaggcaagcccagcttcagaaacctgacagccttccccagtggggcc
aaggagctgctgctgagagacctggaccagctcttcctttcctctgactgccgccatttc
aaccgaactgagtctctgaggcttgctgatgagctgagtggctgggtccaacgtcaccag
agaggtcaccagagaggtcgtcggaagatacctcatagggcccaggagagacagaagtct
cagctacggaagaagtcccctccagtgaaaccagtccccacccaacctccaggaccccct
gaaagggaccccgtgggccagctgcagctctaccgccacccaggccgctcacagccggag
tttctagatgcaattgaccggagggaagataccttctatgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacatccaggcccaagatgtcgttggtg
atgccagccatggcccccaatgagaccgtgtcaggccgggggcccgctggggactatgag
gagatgatgcagattgagtgtgaagtcatggacaccagggtgattcacatcaagacctcc
acggtgcccccctcacttcggaagcagccgtccccgtccccaggcaataccacaggtggc
cccttgccaggctccgcagccagtccggcccgtcaggcctcccgccagcccctctacctc
aatcatccctga

DBGET integrated database retrieval system