KEGG   Rhodococcus opacus PD630: Pd630_LPD00009
Entry
Pd630_LPD00009    CDS       T03071                                 

Definition
(GenBank) DNA gyrase subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD00009
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00009
Enzymes [BR:roa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     Pd630_LPD00009
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Topoisomerases
   Pd630_LPD00009
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      Pd630_LPD00009
SSDB
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Other DBs
NCBI-ProteinID: AHK27260
LinkDB
Position
9967..12009
AA seq 680 aa
MAAQKSDKSTSSKDYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNSVDEA
MAGHASKVEITLLEDGGVQVVDDGRGIPVGMHASGVPTVEVVLTQLHAGGKFDSDSYAVS
GGLHGVGISVVNALSTRLDVDIKRDGFQWNQTYTDSKPGELVKGEATKETGTTVTFWADP
NIFETTVYSFETVARRLQEMAFLNKGLTITLTDERVSDAEVTEEVVSQVADAPKTAEDES
AEAGAPAVHKVKTRVYHYPGGLEDYVRHINRTKQPIHNSVVGFTAKGTGHELEIAMQWNS
GYSESVHTFANTINTHEGGTHEEGFRSALTATVNKYALDKKLLKEKDPKLTGDDIREGLA
AIISVKVGEPQFEGQTKTKLGNTEVRSFVQKASNEHLSHWFEANPADAKTIVNKAVSSAQ
ARVAARKARELVRRKSATDLGGLPGKLADCRSNDPSKSEIYIVEGDSAGGSAKSGRDSMY
QAILPLRGKIINVEKARIDRVLKNTEVQSIITAFGTGIHDEFDIAKLRYHKIVLMADADV
DGQHIATLLLTLLFRFMRPLVEHGHVYLAQPPLYKLKWQRSDPEFAYSDRERDVLVKAGL
ESGKKINKDDGIQRYKGLGEMNAKELWETTMDPTVRVLRLVTLDDAAAADELFSVLMGED
VEARRSFITRNAKDVRFLDV
NT seq 2043 nt   +upstreamnt  +downstreamnt
gtggctgcccagaagtcagacaaaagcacctccagcaaggactacggcgcttcttccatc
accgtcctcgagggactcgaagccgttcgtaagcgaccgggtatgtacatcggttccacc
ggtgaacgtggtctccaccatttgatctgggaagtcgtcgacaactccgtcgacgaggcc
atggccggccacgccagcaaggtcgagatcaccctcctcgaagacggtggcgtccaggtc
gtcgacgacggtcgaggcatccccgtcgggatgcacgcctccggtgtccccaccgtcgag
gtcgtcctcacccagctccacgccggcggcaagttcgactccgactcctacgccgtgtcc
ggcggtctgcacggtgtcggtatctccgtcgtcaacgcgctgtccaccaggctcgacgtc
gacatcaagcgcgacggcttccaatggaaccagacctacaccgactcgaagccgggtgaa
ctcgtcaagggcgaggccaccaaggaaacgggcaccacggtcacgttctgggccgacccg
aacatcttcgagaccacggtctacagcttcgagacggtcgcgcgccgcctccaggagatg
gccttcctcaacaagggcctcacgatcaccctcaccgacgagcgcgtcagcgacgccgag
gtcaccgaagaggtcgtcagccaggtcgcggacgcgccgaagaccgccgaggacgagtcc
gccgaggcgggtgcgcctgccgtgcacaaggtgaagacccgcgtctaccactacccgggc
ggcctcgaggactacgtgcggcacatcaaccgcacgaagcagccgatccacaactccgtc
gtcggtttcaccgcgaagggcaccggccacgaactcgagatcgcgatgcagtggaactcc
ggttactcggagtcggtccacacgttcgcgaacaccatcaacacccacgagggcggcacc
cacgaagagggcttccgttccgctctgacggcgacggtcaacaagtacgcgctcgacaag
aagctcctcaaggagaaggacccgaagctcaccggtgacgacatccgtgagggcctcgcg
gcgatcatttcagtgaaggtcggtgaaccgcagttcgagggtcagacgaagacgaagctc
ggtaacaccgaggtccggtcgttcgtgcagaaggcgagcaacgagcacctgtcgcactgg
ttcgaggcgaatccggccgacgcgaagaccatcgtgaacaaggcggtgtcgtcggcgcag
gcccgcgtcgccgcccgcaaggcccgcgaactggtgcgccgcaagagcgcgaccgatctc
ggcggcctgccgggcaagctcgccgactgccggtccaacgatccgagcaagtccgagatc
tacatcgtggagggtgactccgcaggcggctcggccaagtccggccgcgactcgatgtat
caggcgatcctgccgctgcgcggaaagatcatcaacgtcgagaaggcacgcatcgaccgt
gtgctgaagaacacggaagtccagtcgatcatcaccgcgttcggcacgggcatccacgac
gaattcgacatcgcgaagctgcggtaccacaagatcgtgctgatggccgacgccgacgtc
gacggccagcacatcgcaacgctgctgctcacgctgctgttccgcttcatgcgcccgctc
gtcgagcacggccacgtctacctggcacagcccccgctgtacaaactgaagtggcagcgc
agcgacccggagttcgcgtactccgaccgcgagcgcgacgtcctggtcaaggccggcctc
gagtccggcaagaagatcaacaaggacgacggcatccagcgttacaaaggtctcggcgag
atgaacgccaaggaactgtgggagaccacgatggatccgacggtgcgcgtcctgcgtctg
gtgacgctcgacgacgcggccgcagccgacgagctgttcagcgttctcatgggtgaggac
gtcgaggcccggcgtagcttcatcacccgtaacgccaaggatgtccgcttcctcgacgtc
tag

DBGET integrated database retrieval system