KEGG   Rhodococcus opacus PD630: Pd630_LPD01465
Entry
Pd630_LPD01465    CDS       T03071                                 

Definition
(GenBank) putative DNA repair helicase RAD25
  KO
K10843  DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    Pd630_LPD01465
  09124 Replication and repair
   03420 Nucleotide excision repair
    Pd630_LPD01465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:roa03021]
    Pd630_LPD01465
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD01465
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pd630_LPD01465
Transcription machinery [BR:roa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Pd630_LPD01465
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Pd630_LPD01465
SSDB
Motif
Pfam: Helicase_C_3 ERCC3_RAD25_C ResIII Helicase_C SNF2_N DEAD
Other DBs
NCBI-ProteinID: AHK28694
LinkDB
Position
complement(1491252..1492931)
AA seq 559 aa
MTDGPLIVQSDKTLLLEVDHERANDARQAIAPFAELERAPEHVHTYRITPLALWNARAAG
HDAEQVVDALVNFSRYAVPQPLLVDIVDTMARYGRLQLVKNPAHGLTLVSLDRAVLTEVT
RHKKIAPMLGARVDDDTVVVHPSERGRLKQLLLKVGWPAEDLAGYVDGEAHAIDLDFDGT
SPGSADGQWHLRDYQEMAADSFWAGGSGVVVLPCGAGKTMVGAAAMAKAKATTLILVTNT
VAGRQWKRELIARTSLTEEEIGEYSGERKEIRPVTIATYQVITRRTKGEYKHLELFDSRD
WGLVIYDEVHLLPAPVFRMTADLQSRRRLGLTATLVREDGREGDVFSLIGPKRYDAPWKD
IEAQGWIAPADCVEVRVTLTDAERMSYAVAEPDERYKLCSTAHTKIAVVKSILERHTDAP
TLIIGAYLDQLDELGEALNAPVIKGSTKNKEREELFDRFRAGEIQTLVVSKVANFSIDLP
EASVAVQVSGTFGSRQEEAQRLGRLLRPKHDGGQAHFYSVVARDTLDAEYAAHRQRFLAE
QGYAYRITDADDLLGPAIG
NT seq 1680 nt   +upstreamnt  +downstreamnt
gtgaccgacggaccgttgatcgtccaatccgacaagaccctgctgttggaggtcgatcac
gaacgcgcgaacgacgcccgccaggcgatcgcgccgttcgcggaactcgagcgcgcgccc
gagcacgtccacacctaccggatcaccccgctggccctgtggaacgcgcgcgccgccgga
cacgacgccgagcaggtggtcgatgcgctggtcaacttctcccggtacgcggtgccccag
ccgctgctggtcgacatcgtcgacacgatggcccggtacgggcggctgcagctggtgaag
aacccggcccacggtctgacgctggtcagcctggaccgcgcggtcctcaccgaggtgacc
cggcacaagaagatcgccccgatgctcggtgcccgcgtcgacgacgacaccgtcgtggtc
cacccgagcgagcgcggccgtctcaagcagttgctgctcaaggtcggctggccggcggag
gacctcgccgggtacgtcgacggcgaggcgcacgccatcgacctggacttcgacggcacg
tcccccgggtccgcggacggccagtggcacctgcgtgactatcaggagatggccgccgac
tcgttctgggcgggcgggtccggcgtcgtggtcctgccctgtggtgcgggtaagaccatg
gtcggtgcggcggcgatggccaaggcgaaggccaccacgttgatcctggtgacgaatacg
gtcgcgggacggcagtggaagcgtgagctgatcgcgcgcacgtcgctcaccgaggaggag
atcggcgagtactcgggcgagcgcaaggagatccggccggtcacgatcgccacgtaccag
gtgatcacccggcgcaccaagggcgaatacaagcatctggaactgttcgattcccgcgac
tggggtctcgtgatctacgacgaggtgcacctcctgcccgccccggtcttccgcatgacc
gccgacctgcagtcccgtcgacgcctcggcctcaccgccaccctggtgcgcgaggacggc
cgcgagggcgacgtgttctcgctgatcggacccaagcggtacgacgcgccgtggaaggac
atcgaggcgcaggggtggatcgcgcccgccgactgcgtcgaggtgcgggtgacgctgacg
gacgccgaacggatgtcctacgccgtcgccgaacccgacgaacggtacaagctgtgttcc
accgcacacaccaagatcgcggtggtgaagtcgatcctggaacggcacaccgacgcaccg
acgttgatcatcggcgcgtacctcgaccagctcgacgaactgggtgaggcgttgaacgca
ccggtcatcaaggggtcgaccaagaacaaggagcgggaggaactgttcgaccgtttccgg
gcgggcgagatccagacgctggtcgtcagcaaggtcgcgaacttctcgatcgacctgccg
gaagcatctgtcgccgtccaggtttcgggtacgttcggttcccgccaggaggaggctcag
cggctgggccgcctgctgcgacccaagcacgacggcggccaggcccacttctactcggtg
gtggcccgcgacacgctcgacgccgagtacgccgcccaccggcagcgcttcctcgccgag
caggggtacgcgtaccggatcaccgacgccgacgacctgctgggcccggccatcgggtaa

DBGET integrated database retrieval system