KEGG   Rhodococcus opacus PD630: Pd630_LPD03409
Entry
Pd630_LPD03409    CDS       T03071                                 

Definition
(GenBank) LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:roa01002]
    Pd630_LPD03409
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03409
Enzymes [BR:roa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     Pd630_LPD03409
Peptidases and inhibitors [BR:roa01002]
 Serine peptidases
  Family S24: LexA family
   Pd630_LPD03409
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD03409
SSDB
Motif
Pfam: LexA_DNA_bind Peptidase_S24 MarR_2 HTH_IclR HTH_27 MarR HTH_Crp_2 Sigma70_r4 HTH_20 HTH_6 HTH_12 HTH_24 FaeA
Other DBs
NCBI-ProteinID: AHK30628
LinkDB
Position
complement(3606499..3607230)
AA seq 243 aa
MKDDSSTDGSTPRVSGGSAAGLTDRQRRVLEVIRTSVNERGYPPSIREIGDAVGLTSTSS
VAHQLRTLERKGFLRRDPNRPRAVDVRGLDEVAAGAAANASAAVGLAAVKSGADGAPLPE
PTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGQGSLFLLKVVGESMIDAAICDGDWVV
VRQQNVAENGDIVAAMIDGEATVKTFKRTENEVWLMPHNPLFDPIPGNDAVILGKVVTVM
RKI
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaggacgacagctcgaccgacggttcgactccacgtgtgagcggtggctccgccgcc
gggttgaccgaccggcagcgccgtgtcctcgaggtgattcgcacgtcggtgaacgagcgc
ggatatccgccgagcatccgcgaaatcggcgacgccgtggggctcacctccacctcgtcc
gtcgctcatcagctgcgcacgctggagcggaagggcttcctccgccgggatcccaatcgt
ccgcgcgccgtggacgtgcgcggcctcgacgaggtggcggcgggagccgcggcgaacgcg
agcgccgcagtcgggttggccgcggtcaagtccggcgccgacggcgcacccctgccggaa
cccacgttcgtcccggtcctcggccggatcgcggccggtggcccgatcctcgccgaggaa
gcagtggaggacgtcttcccgcttccccgcgaattggtgggccagggctcgctgttccta
ctcaaggtcgtcggcgaatcgatgatcgatgccgcgatctgcgacggcgactgggtggtg
gtccgtcagcagaacgtggcggagaacggagacatcgtggcagcgatgatcgacggcgaa
gccaccgtcaagacgttcaagcgcaccgagaacgaggtgtggctgatgccgcacaatccg
ctgttcgatccgatccccggcaacgacgcggtcattctgggcaaggtcgtcacggtcatg
cgcaagatctag

DBGET integrated database retrieval system