KEGG   Rhodococcus opacus PD630: Pd630_LPD04033Help
Entry
Pd630_LPD04033    CDS       T03071                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Pd630_LPD04033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD04033
Enzymes [BR:roa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pd630_LPD04033
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Pd630_LPD04033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AHK31246
UniProt: W8H0B9
LinkDB All DBs
Position
4226095..4227036
Genome map
AA seq 313 aa AA seqDB search
MLATLGQLPGGAGWAFEMKWDGQRAIATVDNGVSRLFSRNGNDITATFPELAVPIVAALD
GREATLDGEIVALDANGRPSFSRLQRRMHVLSPIAQLRNEVPVTYYVFDVLALDGKSTTG
LPYLRRRAELTDLALSGPRLQVPPYWTDVDGEEMLDLARRHHLEGAVAKRVDSTYQPGRR
SPAWIKQPLRANTEGIVVGWVDGTGAARDGIGSLLLAAYDDDHQLVYIGHVGTGFTTATR
KSLREQLTALERPTSPLASPPPARETKDARWVEPQLVGDVEYREYTSGRLRHPSWKGLRD
DKTPSEVDLPGRH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctggccacactcggccaacttcccggcggtgcggggtgggcgttcgaaatgaagtgg
gatggtcaacgcgccatcgccaccgtcgacaacggtgtatcccggctgttcagccgcaac
ggaaatgacatcactgcaacctttccggagttggccgtgccgatcgtggccgcgttggac
ggacgtgaggcaaccctcgacggagaaatcgtcgcgctcgacgcgaacggccggccgtcg
ttcagtcgcctccagcggcgcatgcacgtgctgtcccccatcgcacaactccgcaacgag
gtgcccgtcacgtactacgtgttcgacgtcctagcccttgacggcaaatcgacgaccggg
ctgccttacctgcggcgacgggccgaactcaccgaccttgcgctgtccgggccccgcctg
caggtgccgccgtactggaccgacgtcgacggcgaggagatgctcgatctcgcccgcagg
caccatctcgagggcgcagtcgcaaaacgcgtcgactcgacgtatcaacccggtcgccgc
tcccctgcctggatcaagcaaccgctacgcgccaacaccgaagggatcgtcgtcggctgg
gtcgacggcaccggtgccgcccgcgacggcatcggatcactactcctcgccgcgtatgac
gacgaccaccagctggtgtacatcgggcatgtcggcaccggattcaccaccgcgacaagg
aaatcgctacgggagcagctcacggcgctggaacgaccgacgagtcctctggcgtcgccg
ccacctgcgcgggagaccaaggacgcacgctgggtcgaaccgcagttggtcggcgacgtc
gagtaccgcgagtacaccagcgggcggttgcgccaccccagctggaaaggcctgcgtgac
gacaagacgcccagcgaagtcgacttgcccggtcggcactga

DBGET integrated database retrieval system