KEGG   Raoultella ornithinolytica S12: TE10_09060Help
Entry
TE10_09060        CDS       T03629                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ron  Raoultella ornithinolytica S12
Brite
KEGG Orthology (KO) [BR:ron00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TE10_09060
Enzymes [BR:ron01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TE10_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Thi4 K_oxygenase FAD_binding_3 DAO Glutaredoxin NAD_binding_8 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJF72212
LinkDB All DBs
Position
1964719..1966284
Genome map
AA seq 521 aa AA seqDB search
MLEANMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSEKVTFKEDNTLAV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLTCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNEYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVVGD
GSKVTGLQYRDRLSGDEHHVELAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagcaaacatgaaaacccagctcaaggcctatcttgagaaactgaccaaacct
gttgagctgattgcgacgctggacgacagcgctaaatcggcagaaatcaaagaactgctg
gcagaaatcgctgagctgtctgagaaagtgacgtttaaagaagacaacacgctcgccgtg
cgcaaaccgtctttcctgattacgaatccaggttctacccaggggccgcgctttgccggc
tctccgctggggcacgagtttacctctctggttctggcgctgctgtggaccggcggccat
ccgtcgaaagaggcccaggccctgctggaacagatccgcgacctcgacggtgattttgag
tttgaaacctactactcgctcacctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtattaagcatacggcgattgacggcgggacgttccag
aatgagattaccgatcgtaacgtgatgggcgttccggcggtctttgtcaacggcaaggag
tttggccaggggcgcatgacgctggcggagatcgtcgcgaaagttgacaccggcgcggag
aaacgtgccgcggaagagctgaacaagcgcgacgcttacgacgtgctgatcgtcggctcc
ggcccgtccggcgcggcggcggcggtttactcggcgcgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggccaggtgctggataccgtggatatcgaaaactacatttcg
gtaccgaaaaccgaaggtcagaagctggccggggcgctgaaggctcacgtcaatgaatat
gatgtggacgtcattgactcccagagcgcgtcgaaactggttccggcggcggtagaaggc
ggcctgcatcagattgaaaccgcctccggcgcggtgctgaaggcgcgcagtatcatcatc
gccaccggcgccaaatggcgtaacatgaacgtgccgggtgaagatcagtaccggacgaaa
ggggtgacctattgcccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtg
atcggcggcggcaactccggcgtcgaggcggcaatcgatctggcgggcgtggttgaacac
gtgacgctgctggaattcgcccccgaaatgaaggcggaccaggtgctgcaggacaaagta
cgcagcctgaaaaacgtcgacattattcttaacgcacagactacggaagtggtcggtgat
ggcagtaaggtgaccggactgcagtatcgcgatcggctgagcggtgatgagcatcacgtc
gagctggcggggatcttcgtacagattggcctgctgcctaataccacctggctggaaggc
gcgattgagcgtaaccggatgggtgaaattatcatcgatgcgaagtgcgaaactaacgtc
aagggcgtgtttgccgcgggcgactgcaccaccgtaccgtacaagcagattattatcgcc
gccggcgaaggggcaaaagcgtctctgagctcgttcgattatctgattcgtaccaaaacc
gcataa

DBGET integrated database retrieval system