KEGG   Rhodococcus opacus B4: ROP_51120
Entry
ROP_51120         CDS       T00882                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
rop03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rop00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ROP_51120 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rop03400]
    ROP_51120 (ligD)
Enzymes [BR:rop01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ROP_51120 (ligD)
DNA repair and recombination proteins [BR:rop03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ROP_51120 (ligD)
SSDB
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Other DBs
NCBI-ProteinID: BAH53359
NITE: ROP_51120
UniProt: C1ATU5
LinkDB
Position
5527049..5529325
AA seq 758 aa
MATAGTRQLTVDGHRLSLTNLGKVLYPESGTVKGEVIDYYSRIAPAMLPHVVDRPATRKR
WPNGVDSEPFFEKNLAASAPGWLERRALEHSDRSVHYPLLNSVAALVWAGQQAALELHVP
QWRFDGSHRGPATRIVFDLDPGPGVGLVECAEVARAVRDLVANLGWTAYPVTSGSKGIHL
YVPLDRKLDGSGASTVAKQVATGLEKLRPELVTATMAKSVRAGKVFVDWSQNNPSKTTIA
PYSLRGRSEPYVAAPRSWDELDDPGLRQLRFEEVLERWESDGDLLAGLDPPIEDDTALAE
YRRKRDPGRTPEPMPHTVQPGAGNSFVIQEHHARRLHYDLRLERDGVLVSWAVPKNVPTT
TGENRLAVHTEDHPLEYLTFSGSIPKGEYGGGQMTIWDTGTYDTEKWRDDEVIVQLHGEQ
VEGRFALIRTKGDQWLMHLMKDQSPGGSRSSELPRGLSPMLASPGTLDGLGADEWAFEGK
WDGIRVIAEISGGELKMTSRAGNDKTRDYAQLGWLADSLEDHEVVLDGEVVAFDERGVAN
FGLLQQGNEPHFLAFDVLYLDGVSLLRKKYTDRRRVLEALAAKVDDLVVPPQLHGSAQEA
LDESRRKGWEGVVAKRRESVYLPGKRGSSWIKVKNWRTQEAVIGGWRRGQGGRSSGIGSV
LLGVPEDEGLRYIGRVGTGFTERDLQELAATLGPLETDTSPFVEDLPTADRKGAVWVTPT
LVAEVRFMDWTGSRRLRHPSWRGLRNDKAPEDVEVESS
NT seq 2277 nt   +upstreamnt  +downstreamnt
gtggccactgcgggaactcggcaactgaccgtcgacgggcatcgcctgtctctgaccaac
ctcggcaaggtgctctacccggagtcgggcaccgtgaagggcgaggtgatcgactactac
tcgcggatcgccccggccatgctgccgcacgtcgtggaccgtcccgccacccgcaaacgc
tggcccaacggggtggacagcgagccgttcttcgagaagaacctcgcggcctccgcgccg
gggtggctggagcgtcgcgcactcgagcactcggaccgttcggtgcactacccgcttctg
aactcggtcgcggccctcgtgtgggcgggacagcaggccgcactcgaactgcacgtgccg
cagtggcggttcgacgggtcgcaccggggtccggcgacccgcatcgtcttcgacctcgac
cccggccccggtgtgggcctcgtcgaatgcgcggaggtggcgcgggccgtgcgcgacctg
gtcgcgaacctcggctggaccgcgtacccggtcaccagcggcagcaagggtattcacctg
tacgtgccgctcgaccggaaactggacggttcgggcgcgtcgaccgtcgcgaaacaggtg
gcgacggggctggagaagctgcgtcccgaactcgtcaccgcgaccatggccaagtcggtg
cgcgcgggcaaggtattcgtcgactggagtcagaacaatccgtccaagaccaccatcgcc
ccgtactcgctgcgcgggcgctccgagccgtacgtcgcggcgccgcggagctgggacgaa
ctcgacgaccccggcctacgacagctgaggttcgaggaagtgctcgaacggtgggagtcg
gacggcgacctgctcgccggactcgatccgccgatcgaggacgacaccgccctcgccgag
taccgccgcaagcgtgatcccggacggacacccgagccgatgccgcacacggtgcagccg
ggggcgggcaacagcttcgtcatccaggaacatcacgcccggcgcctccactacgacctg
cggctcgaacgggacggcgtcctcgtgtcgtgggcggtgccgaagaacgtgccgacgacg
acgggggagaatcgcctggccgtgcacaccgaggatcatccgctcgaatacctcacgttc
tccgggagcatccccaagggtgagtacggcggcggccagatgacgatctgggacacggga
acctacgacacggagaagtggcgggacgacgaggtgatcgtccagctgcacggtgagcag
gtggagggccggttcgcgctgatccgcacgaagggcgaccagtggctgatgcacctgatg
aaggaccagtccccgggcgggtcgcggtcgtcggagctgccgcgcgggttgtcgccgatg
ctcgcgagccccggcaccctcgacggcctcggcgccgacgagtgggctttcgaagggaag
tgggacggcatcagggtgatcgccgagatcagtggcggcgaactgaagatgacgagccgc
gcgggtaacgacaagacccgggactacgcgcaattgggttggctggcagattctctcgaa
gatcacgaggtggtcctcgacggtgaagtggtcgcgttcgacgagcggggtgtcgcgaac
ttcggcctgttgcagcagggcaacgagccgcacttcctcgcgttcgacgtgctgtacctc
gacggagtgtcgttgctgcgcaagaagtacaccgatcggcgccgcgtcctcgaggcgctg
gcagccaaggtggacgacctcgtcgttcccccgcaactgcacgggtccgcgcaggaagcc
ctggacgagagccgtcgcaaggggtgggagggtgtggtggccaaacgccgcgaatccgtg
tacctgccgggcaagcgggggtcgagctggatcaaggtgaagaactggcgcacacaggaa
gccgtgatcggcgggtggcgccgcggccagggcgggcggtccagcggaatcggttcggtg
ctgctcggcgtccccgaggacgaggggctgcgctatatcggacgcgtcggaaccggcttc
accgaacgggatctgcaggaactcgcagccaccctgggaccgctcgaaaccgacacctcc
ccgttcgtcgaagacctgcccaccgccgaccgcaagggggccgtgtgggtgacccccacc
ctggtcgcggaggtgcggttcatggactggaccggctcgcgaagactgcggcaccccagc
tggcgtgggctccgaaacgacaaggcgcctgaagatgtcgaggtggagtcctcatga

DBGET integrated database retrieval system