Raoultella ornithinolytica B6: RORB6_15955 Help Entry RORB6_15955       CDS       T02625                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ror  Raoultella ornithinolytica B6 Pathway ror00362   Benzoate degradation ror00621   Dioxin degradation ror00622   Xylene degradation ror01100   Metabolic pathways ror01120   Microbial metabolism in diverse environments ror01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ror00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     RORB6_15955    00622 Xylene degradation     RORB6_15955    00621 Dioxin degradation     RORB6_15955 Enzymes [BR:ror01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      RORB6_15955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AGJ87872 LinkDB All DBs Position complement(3500139..3500321) Genome browser AA seq 60 aa AA seqDB search MPVLHLELQPGRSPEQKRDFAREVTRVAVETLKCKAESVDVVIVEIPKTHWAKGGVLPTE NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgcctgttttacatttagaattacagcctggccgctcgcctgaacagaagcgcgatttt gcccgtgaagtgacccgggtcgcggttgaaacgctgaaatgcaaagcggagagcgtggat gtggtcattgtcgaaatacccaaaacgcactgggctaaaggaggcgtattgcccaccgaa tag

DBGET integrated database retrieval system