Ralstonia pickettii 12D: Rpic12D_3686 Help Entry Rpic12D_3686      CDS       T00925                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism rpf  Ralstonia pickettii 12D Pathway rpf01100   Metabolic pathways rpf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rpic12D_3686   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rpic12D_3686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  ACS64945 UniProt:  C6BLI7 LinkDB All DBs Position 2:241091..241336 Genome browser AA seq 81 aa AA seqDB search MTDTEILERIRAIFKENFAIEPERVTLGAHLFEDLDLDSIDAVDLAIKLQEMTGRRIKPE EFKTVRTVNDVVGAVESLLAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacggacaccgagatcctcgaacgcattcgcgccattttcaaagagaacttcgctatc gaaccggagcgtgtcacgctcggggcgcatctgttcgaagacctggacctggacagcatc gacgccgtcgacctcgccatcaagttgcaggaaatgaccgggcgccgcatcaaacccgaa gagttcaagacggtgcgcacggtcaacgacgtcgttggcgcggttgaatctctgctggcg gcgtaa

DBGET integrated database retrieval system