KEGG   Ralstonia pickettii 12D: Rpic12D_4055Help
Entry
Rpic12D_4055      CDS       T00925                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpic12D_4055
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Rpic12D_4055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored Glutaredoxin AlaDh_PNT_C DAO FAD_binding_3 FAD_binding_2 Thi4 baeRF_family10 FMO-like NAD_binding_8 K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ACS65304
UniProt: C6BMJ6
LinkDB All DBs
Position
2:643830..645404
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMDLLRDVAEQSSMIVLTEQRDAAE
RAPSFLIRRTGADVSVRFAAIPTGHEFTSLVLALLQVGGYAPKLEADVIEQIRNIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALYQGEIEARQIMAVPTVFLNGET
FGTGRMGVEEILAKIDTGAAARDAEKLAAKEAFDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTLGIENFISVQETEGPKFAAALEQHVRQYDVDIMNTQRAVKLTPADKPG
GFAEVTLANGAVLKGRSVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVSHVTLLEFASELKADAVLVRKLQSLPNATIVTNAQTTEITGD
GQKVNGLRYKSRVDGVEHTVALEGVFVQIGLVPNTEWLDGALERNRFGEIVVDARGQTSA
EGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgctgatgtcaaggcccaactgaaggcctacctcgaacgcctcgtgcagccc
attgagctggtcgccaacgtcgatgacagcgagggctcccgcgacatgatggacctgctg
cgcgacgtggccgagcagtccagcatgatcgtgctgaccgaacaacgcgacgctgccgag
cgcgcaccgtcgttcctgatccgccgcaccggcgcggatgtgagcgtgcgttttgccgcc
atcccgaccggccacgagttcacctcgctcgtgctggcgctgctgcaagtgggcggctat
gcgcccaagctcgaagccgacgtcatcgagcagattcgcaatatcgaaggggatttccgc
ttcgagacctacatgtcgctcacgtgccagaactgcccggacgtggtccaggcgctgaac
gtgatgtccgtgatcaacccgcgcatccagcacgtcgccattgacggcgcgctgtatcag
ggcgaaatcgaagcacgccagatcatggccgtgccgaccgtgttcctgaacggcgagacg
ttcggcacgggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgcc
gcgcgtgacgctgaaaagctcgccgccaaggaagcgtttgatgtgctgatcgttggcggt
ggcccggcgggtgccgcggctgcggtgtacgcggcacgcaagggcgtgcgcaccggcgtg
gtggccgagcgttttggcggtcaggtgctcgacacgctgggcatcgagaacttcatctcc
gtgcaggagaccgaagggccgaagtttgccgccgcgctggagcagcacgtgcgccagtac
gacgttgacatcatgaacacgcagcgcgcagtcaagctcacgccggcagacaagccgggc
ggctttgccgaggtgacgctggccaacggcgcggtgctcaagggccgctcggtcatcctg
tcgaccggtgcacgctggcgcaacgtcaatgtgccgggcgagcaggaatacaagaacaag
ggcgtggcgtactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggccgtc
atcggcggcggcaactcgggcgtggaagccgccatcgacctggccggcctggtgagccac
gtcacgctgctggaattcgccagcgagctgaaggccgatgccgtgctggtgcgcaagctg
caaagcctgccgaacgcgaccatcgtcaccaacgcgcagaccaccgagatcaccggtgac
ggccagaaggtcaatggcctgcgctacaagagccgcgtggatggcgtcgagcacacggtc
gcgctcgaaggcgtgttcgtgcagatcggcctggtgcccaacaccgaatggctggacggc
gcgcttgagcgcaatcgctttggcgagatcgtcgtcgacgcacgtggccagaccagcgcg
gaaggtgtgttcgctgcaggcgatgcgaccacgacgccgtacaagcagatcatcatcgcc
accggcgatggcgcgaaggccgcattgtcggcgttcgatcatctgatccgcgtgccgctg
gccgaagcggcctga

DBGET integrated database retrieval system