KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4136
Entry
Rpdx1_4136        CDS       T01381                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00362  Benzoate degradation
rpx01100  Metabolic pathways
rpx01120  Microbial metabolism in diverse environments
rpx01220  Degradation of aromatic compounds
Module
rpx_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpdx1_4136
Enzymes [BR:rpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     Rpdx1_4136
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ADU45691
UniProt: E6VL87
LinkDB
Position
4439691..4440467
AA seq 258 aa
MSSNPILTETQGRVGIITLNRPEVLNALNDALMDALGAALLAFDADDSIGAIVITGNARA
FAAGADITAMAEASYSDVYGSNFITRNWETIRRVRKPVLAAVAGLAYGGGCELALACDIV
IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV
VDDDKLRDETVALASTIAAFSAPALMALKESLNRTFESTLAEGILFERRELHARFASADA
HEGIQAFLEKRAPRFTHR
NT seq 777 nt   +upstreamnt  +downstreamnt
ttgtcgtccaatcccatcctcaccgaaacccagggccgggtcggcatcatcacgctgaac
cggcccgaagtcctcaacgcgctgaacgacgccctgatggatgcgctcggcgccgcgctg
ctggcgttcgacgccgacgacagcatcggcgccatcgtgatcaccggcaatgcccgcgcc
ttcgcggctggtgccgatatcacggcgatggcggaagccagctatagcgatgtctacggc
tcgaacttcatcacccgcaattgggagaccatccgccgagtgcgcaagccggtgctggcc
gcggtggcggggcttgcctatggcggcggctgcgaactggcgctcgcctgcgacatcgtg
atcgccggccgcagtgccaaattcgcgctgccggaaatcaagctcggcctgctgcccgga
gcgggcggcacgcaacgcctgccgcgcgcgatcggcaaggcaaaagccatggacatgtgc
ctgtcggcgcgaccgctcaacgccgaagaggccgatcgctacggcctggtatcgcgcgtc
gtcgatgacgacaagctgcgcgacgagaccgtggcgctggccagcacgatcgcggcgttc
tccgccccggcgctgatggcgctgaaggaaagcctcaaccgcaccttcgagagcacgctc
gccgaaggcatcctgttcgagcgccgcgagctgcacgcccgcttcgccagcgccgacgcc
cacgagggcattcaggctttcctggaaaagcgggcgccgcgcttcacccaccgatag

DBGET integrated database retrieval system