KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654043
Entry
104654043         CDS       T03989                                 

Gene name
KCNJ2
Definition
(RefSeq) inward rectifier potassium channel 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04725  Cholinergic synapse
rro04921  Oxytocin signaling pathway
rro04924  Renin secretion
rro04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104654043 (KCNJ2)
   04924 Renin secretion
    104654043 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    104654043 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    104654043 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104654043 (KCNJ2)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   104654043 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 104654043
NCBI-ProteinID: XP_010351429
LinkDB
Position
19
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctacagcattgtctcttcagaagaagacggtatgaag
ttggccaccatggcagttgcaaatggctttgggaacgggaagagtaaagtccacacccga
caacagtgcaggagccgctttgtaaagaaagatggtcactgtaacgttcagttcatcaac
gtgggtgagaaggggcaacggtacctcgcagacatcttcaccacgtgtgtggacattcgc
tggcggtggatgctggttatcttctgcctggctttcgtcctgtcatggctgttttttggc
tgtgtgttttggttgatagctctgctccatggggacctggatgcatccaaagagggcaaa
gcttgtgtgtctgaggtcaacagcttcacggctgccttcctcttctccattgagacccag
acaaccataggctatggtttcaggtgtgtcacggatgaatgtccaattgctgttttcatg
gtggtgttccagtcaatcgtgggctgcatcattgatgctttcatcattggtgcagtcatg
gccaagatggcaaagccaaagaagagaaacgagactctcgtcttcagtcacaatgctgtg
attgccatgagagatggcaagctgtgtttaatgtggcgagtgggcaatcttcggaaaagc
cacttggtggaagctcatgtccgagcacagctcctcaaatccagaatcacttctgaaggg
gagtatatccctctggatcaaatagacatcaatgttgggtttgacagtggaatcgatcgt
atatttctggtgtccccaatcactatagtccatgaaatagacgaagacagccctttatat
gatttgagtaaacaggacattgacaacgcagactttgaaatcgtggtcatactggaaggc
atggtggaagccactgccatgacgacacagtgccgtagctcttatctagcaaatgaaatc
ctgtggggccaccgctatgagcctgtgctctttgaagagaagcactactacaaagtggac
tattccaggttccacaaaacttacgaagtccccaacactcccctttgtagtgcaagagac
ttagcagaaaagaaatatatcctctcaaatgcgaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagatgacagtgaaaatggagttccagaaagcactagtacg
gacacgccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagagtcggagatatga

DBGET integrated database retrieval system