KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657288
Entry
104657288         CDS       T03989                                 

Gene name
NKX2-6
Definition
(RefSeq) homeobox protein Nkx-2.6
  KO
K09346  homeobox protein Nkx-2.6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104657288 (NKX2-6)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104657288 (NKX2-6)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104657288
NCBI-ProteinID: XP_010355353
UniProt: A0A2K6R6J5
LinkDB
Position
9
AA seq 301 aa
MLLSPISSTPFSVKDILRLERERSCLAASPHPGVRKSPENFQYLRMDPEPRGSEVHNAGG
GGGDRRLDGSEPPGGACEAVLEMDAERMAEPQPGLSAASPLGGGTRVPECGVGNGSDCMR
GGRSEQPKARHRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIWF
QNRRYKCKRQRQDKSLELAGHPLTPRRVAVPVLVRDGKPCLGPGPSASAFPSPYGATVSP
YSCYGGYTGAPYGAGYGSCYAGAPSGPAPHTPLASAGFGHSGQNATPQDHLAATLQGVRA
W
NT seq 906 nt   +upstreamnt  +downstreamnt
atgctgttgagccccatctcctccacccccttctcggtcaaggacatcctgcgactggag
cgcgagcggagctgcctcgcggcttcgccacatccgggggtgcggaagagcccggaaaac
tttcagtacctgagaatggacccagagccgcgagggtcagaggttcacaacgctggtggc
ggcggcggtgacagaaggctggacggttcggagcctcctgggggtgcctgtgaggcagtc
ttggagatggacgcggaacggatggcggagccacaacccggcttgagcgcggcctcgccc
ctcggcggcgggaccagggtgccagagtgcggcgttggcaacggcagcgactgcatgcgg
ggtggccgctcggagcagcccaaggcgcggcaccgacggaagccgcgcgtgctcttttcg
caggcgcaggtgctggccctggagcggcgcttcaagcagcagcggtacctgtcagcgccc
gagcgcgagcacctggccagcgcgctgcagctcacgtccacgcaggtcaagatctggttc
cagaaccgacgctacaaatgcaagagacagcgccaggacaagtcgctcgaactggccggc
caccctctaacgccgcgccgagtggcggtgcccgtcttggtgcgcgatggcaagccctgc
ctgggccccgggcccagcgcatctgccttccccagtccctatggcgccacagtgtcgccc
tattcttgctatggaggctacaccggagcaccctacggagcaggctacggcagctgctac
gctggcgcgccctccggtcctgcgccgcacacaccactggccagcgcgggcttcggacac
agtggccagaatgccaccccgcaggaccatctggcagccaccctgcagggcgtcagggcc
tggtga

DBGET integrated database retrieval system