KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663347
Entry
104663347         CDS       T03989                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X2
  KO
K04737  interleukin 3 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663347 (IL3RA)
   04151 PI3K-Akt signaling pathway
    104663347 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104663347 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104663347 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104663347 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663347 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104663347 (IL3RA)
   04090 CD molecules [BR:rro04090]
    104663347 (IL3RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104663347 (IL3RA)
CD molecules [BR:rro04090]
 Proteins
  104663347 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Gemini_mov
Other DBs
NCBI-GeneID: 104663347
NCBI-ProteinID: XP_010362785
UniProt: A0A2K6Q0W7
LinkDB
Position
22
AA seq 378 aa
MVLLWLTLLLVATPCLLQTKEDRNPPIKNLRMKQKTQQLMWDLNRNVTDVECIKDSDDFM
PAMNNSYCQFGAISVCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFL
SCSWAVGPAAPADVQYDLYLNNLNSHEQHKCLHYNTDARGTRIGCRFDDIARLSSGSQRS
HILVRGRSAAFSIPCTDQFVVFSQIERLTPPHMTAECNKTHSFMQWKMRSHFNRKFRYEL
QIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDPEEGAS
SPAWRTSLPIALGTLLAVLCVFLICRRYLVMQRLFPRIPHMKDPIGDSFQDDKLVIWEAG
KAGLEECLVSEVQVVEKT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtcctcctttggcttacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatcgaaacccaccaatcaagaacctaaggatgaaacaaaagactcagcagctgatg
tgggacctgaacagaaacgtgactgacgtggagtgtatcaaagactccgacgactttatg
ccggccatgaacaatagctattgccagtttggagccatttccgtatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacgcctcgggcaggcgcggagaatctgacctgctgggttcatgatgtggatttcttg
agctgcagctgggcggtaggcccggcagcccccgctgacgtccagtacgacctgtacttg
aacaatctcaacagccacgaacagcacaagtgtcttcactacaacacggatgctcgggga
acacggatcgggtgtcgtttcgatgacatcgctcgactctccagcggttctcaacgttcc
cacatcctggtgaggggcaggagcgcagccttcagtatcccctgcaccgatcagtttgtc
gtcttttcacagatcgagagattaactccaccccacatgactgcagagtgtaataagaca
cattccttcatgcagtggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatccaaaagagaatgcagcctgtaagaacagaacaggtcagagacacaacctccttc
cagctacccaatcctggaacatacacagtgcaaataagagcccgggaaacagtgtatgaa
ttcttgagtgcctggagcaccccccagcgcttcgagtgcgacccggaggagggcgcgagc
tcgcctgcctggcggacgtcgctgccgatcgcgctggggacgctgctggccgtgctctgt
gtcttcctcatctgcagaaggtatctggtgatgcagagactatttccccgcatcccacac
atgaaagaccccatcggtgacagcttccaagacgacaagctggtgatctgggaggcgggc
aaagccggcctggaggagtgtctggtatctgaagtacaggtggtggagaaaacttga

DBGET integrated database retrieval system