KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663703
Entry
104663703         CDS       T03989                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C, slow skeletal and cardiac muscles
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104663703 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104663703 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    104663703 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663703 (TNNC1)
   05414 Dilated cardiomyopathy
    104663703 (TNNC1)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     104663703 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF1707 DUF5580 EF-hand_10 Dak2 EMG1
Other DBs
NCBI-GeneID: 104663703
NCBI-ProteinID: XP_010363314
UniProt: A0A2K6P873
LinkDB
Position
1
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaggcagcctttgacatcttcgtgctgggtgctgaggatggctgcatcagcaccaaggag
ctgggcaaggtgatgaggatgctgggccagaaccccacccctgaggagctgcaggagatg
attgacgaggtggacgaggacggcagcggcacggtggactttgatgagttcttggtcatg
atggttcgatgcatgaaggatgacagcaaagggaaatctgaggaggagctgtctgacctc
ttccgcatgtttgacaaaaacgctgatggctacatcgacctggatgagctgaagatgatg
ctgcaggctacaggcgagaccatcacggaggacgacatcgaggagctcatgaaggacgga
gacaagaacaacgatggccgcatcgactatgatgagttcctggagttcatgaagggtgtg
gagtag

DBGET integrated database retrieval system