KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664914
Entry
104664914         CDS       T03989                                 

Gene name
LMNA
Definition
(RefSeq) lamin
  KO
K12641  lamin A/C
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04210  Apoptosis
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104664914 (LMNA)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104664914 (LMNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104664914 (LMNA)
   05414 Dilated cardiomyopathy
    104664914 (LMNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104664914 (LMNA)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     104664914 (LMNA)
SSDB
Motif
Pfam: Filament LTD TPR_MLP1_2 HAUS-augmin3 ATG16 Crescentin Fez1 TolA_bind_tri CENP-F_leu_zip Tht1 Spc7
Other DBs
NCBI-GeneID: 104664914
NCBI-ProteinID: XP_010364898
UniProt: A0A2K6QHI1
LinkDB
Position
8
AA seq 663 aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLMAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK
LESESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTY
RFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMR
KLVRSVTVVEDDEDEDGDDLLHHHHGSHCTSSGDPAEYNLRSRTVLCGTCGQPADKASAS
GSGAQMGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNC
SIM
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggagaccccgtcccagcggcgcgccacccgcagcggggcgcaggccagttccactccg
ctgtcgcccacccgcatcacccggctgcaggagaaggaggacctgcaggagctcaatgat
cgcttggcggtctacatcgaccgtgttcgctcgctggaaacggagaacgcagggctgcgc
cttcgcatcaccgagtctgaagaggtggtcagccgcgaggtgtccggcatcaaggccgcc
tatgaggccgagctcggggatgcccgcaagaccctcgactcagtggccaaggagcgtgcc
cgcctgcagctggagctgagcaaagtgcgtgaggagtttaaggagctgaaagcgcgcaac
accaagaaggagggtgacctgatggctgctcaggctcggctgaaggacctggaggctctg
cttaactccaaggaggctgcactgagcactgctctcagtgagaagcgcacgctggagggc
gagctgcacgatctgcggggccaggtggccaagcttgaggcagccctgggtgaggccaag
aagcaacttcaggatgagatgctgcggcgggtggatgctgagaacaggctgcagaccatg
aaggaggaactggacttccagaagaatatctacagtgaggagctgcgtgagaccaagcgc
cgtcacgagacacggctggtggagattgacaatgggaagcagcgtgagtttgagagccgg
ctggcggatgccctgcaggaactgcgggcccagcatgaggaccaggtggagcagtacaag
aaggagctggagaagacttattccgccaagctggacaatgccaggcagtctgctgagagg
aacagcaacctggtgggggccgcccacgaggagctgcagcagtctcgcatccgcatcgac
agcctctccgctcagctcagccagctccagaagcagctggccgccaaggaggcgaagctt
cgagacctggaggactcgctggcccgtgagcgggacaccagccggcggctgctagcggaa
aaggagcgggagatggctgagatgcgggcaaggatgcagcagcagctggatgagtaccag
gagcttctggacatcaagctggccctggacatggagatccacgcctaccgcaagctcctg
gagggcgaggaggagaggctacgcctgtcccccagccccacctcacagcgtagccgtggc
cgtgcttcctcgcactcatcccagacacagggtgggggcagcgtcaccaaaaagcgcaag
ctggagtccgagagccgcagcagcttctcacagcacgcacgcactagcgggcgtgtggcc
gtggaggaggtggacgaggagggcaagtttgtccggctgcgcaacaagtccaatgaggac
cagtccatgggcaattggcagatcaagcgccagaatggagatgatcccttgctgacttac
cgcttcccaccaaagttcaccctaaaggctgggcaggtggtaacgatctgggctgcagga
gctggggccacccatagcccccctaccgacctggtgtggaaggcacagaacacctggggc
tgcgggaacagcctgcgcacggctctcatcaactccactggggaagaggtggccatgcgc
aagctggtgcgctcagtgactgtggttgaggacgacgaggatgaggatggagatgacctg
ctccatcaccaccacggctcccactgcaccagctcgggggaccccgctgagtacaacctg
cgctcgcgcaccgtgctgtgcgggacctgcgggcagcctgccgacaaggcatctgccagc
ggctcaggagcccagatgggcggacccatctcctctggctcttctgcctccagtgtcacg
gtcactcgcagctaccgcagtgtggggggcagtgggggtggcagcttcggggacaatctg
gtcacccgctcctacctcctgggcaactccagcccccgaacccagagcccccagaactgc
agcatcatgtaa

DBGET integrated database retrieval system