KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666850
Entry
104666850         CDS       T03989                                 

Gene name
CISH
Definition
(RefSeq) cytokine-inducible SH2-containing protein isoform X2
  KO
K04701  cytokine inducible SH2-containing protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104666850 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104666850 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104666850 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104666850 (CISH)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104666850 (CISH)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   104666850 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box BCA_ABC_TP_C
Other DBs
NCBI-GeneID: 104666850
NCBI-ProteinID: XP_010367287
UniProt: A0A2K6PE73
LinkDB
Position
1
AA seq 258 aa
MVLCVQGPHPLLAVERTGQRPLWAQSLELLETVMQPLPAGAFLEEVAEGTPAQIESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTARGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVTDVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcatcctttgctggctgtggagcggactgggcagcgg
cccctgtgggcccagtccctggaactgctcgagacagtcatgcagcccttgcctgctggg
gccttcctggaggaggtggcagaggggaccccagcccagatagagagtgagccaaaggtg
ttggaccccgaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtattggggttccattacggccagcgaggcccggcaacacctgcagaagatgcca
gagggcacgttcctagtacgtgacagtacccaccccagctacctgttcacgctgtcagtg
aaaactgctcgtggccccaccaatgtgcgcattgagtatgctgactccagcttccgtctg
gactccaactgcttgtccaggccacgcatcctggcctttccagatgtggtcagccttgtg
cagcactatgtggcctcctgcgcggctgacacccgaagcgacagccctgatcctgctccc
accccggccctgcctatgcctaaggaagatgcgcctagtgatccagcactgcctgctcct
ccaccagctactgctgtacacctaaaactggtacagccctttgtacgcagaagcagtgcc
cgcagcctgcaacacctgtgccgccttgtcatcaaccgtctggtgaccgacgtggactgc
ctgccactaccccggcgcatggctgactacctccgacagtaccccttccagctctga

DBGET integrated database retrieval system