KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667395
Entry
104667395         CDS       T03989                                 

Gene name
REN
Definition
(RefSeq) renin isoform X1
  KO
K01380  renin [EC:3.4.23.15]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04614  Renin-angiotensin system
rro04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104667395 (REN)
   04614 Renin-angiotensin system
    104667395 (REN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104667395 (REN)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     104667395 (REN)
Peptidases and inhibitors [BR:rro01002]
 Aspartic peptidases
  Family A1: pepsin family
   104667395 (REN)
SSDB
Motif
Pfam: Asp TAXi_N TAXi_C A1_Propeptide Asp_protease_2
Other DBs
NCBI-GeneID: 104667395
NCBI-ProteinID: XP_010368101
UniProt: A0A2K6P8F8
LinkDB
Position
8
AA seq 406 aa
MDGRRRMSRWGLLLLLWGSCTFSLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLALGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNILSQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggacggacggagaagaatgtctcgctggggactgctgctgctgctctggggctcctgc
accttcagtctcccgacagacaccaccacctttaaacggatcttcctcaagaggatgccc
tcaatccgagaaagcctgaaggaacgaggtgtggacatggccagacttggtcccgagtgg
agccagcccatgaagaggctggcccttggcaacaccacctcctccgtgatcctcaccaac
tacatggatacccagtactatggtgagattggcatcggcaccccaccccagaccttcaaa
gtcgtctttgacactggttcgtccaacgtttgggtgccctcctccaagtgcagccgtctc
tacactgcctgtgtgtatcacaagctcttcgatgcttcggattcctccagctacaagcac
aatggaacagaactcaccctccgctattcaacagggacagtcagtggctttctgagccag
gacatcatcaccgtgggtggaatcacagtgacacagatgtttggagaggtcacggagatg
cctgccttacccttcatgctggccgagtttgatggggttgtgggcatgggcttcattgaa
caggccattggcagggtcacccctatcttcgacaacatcctctcccaaggggtgctaaaa
gaggacgtcttctctttctactacaacagagattccgagaattcccagtcgctgggagga
cagattgtgctgggaggcagcgacccccagcattacgaagggaatttccactatatcaac
ctcatcaagactggcgtctggcagattcaaatgaagggggtgtctgtggggtcatccacc
ttgctctgtgaagacggctgcctggcattggtggacactggtgcatcctacatctcgggt
tctaccagctccatagagaagctcatggaggccttgggggccaagaagaggctgtttgat
tatgttgtgaagtgtaatgagggccctacactccctgacatctctttccacctgggaggc
aaagaatacacgctcaccagcgcggactatgtatttcaggaatcttacagtagtaaaaag
ctgtgcacactggccatccatgccatggatatcccgccgcccactggacccacctgggcc
ctgggcgccaccttcatccgaaagttctacacagagtttgatcggcgtaacaaccgcatt
ggcttcgccttggcccgctga

DBGET integrated database retrieval system