KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668148
Entry
104668148         CDS       T03989                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17 isoform X2
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104668148 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668148 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    104668148 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104668148 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104668148 (ZBTB17)
   04121 Ubiquitin system [BR:rro04121]
    104668148 (ZBTB17)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    104668148 (ZBTB17)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     104668148 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 zinc_ribbon_15 Zn-ribbon_8 zf-C2HC_2 zf-BED zf_UBZ zf-C2HE zf-Di19 Packaging_FI XPA_N HypA DUF3268
Other DBs
NCBI-GeneID: 104668148
NCBI-ProteinID: XP_010369092
UniProt: A0A2K6PQ83
LinkDB
Position
12
AA seq 800 aa
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKTAKEEKAATSMLSRLEQAGRSAPTGPSRDLKEERGGQAQSTASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQEEQEEE
GAGPAEVKEEGPQLENGEAPEENENEESAGTDSGQELGAEARGLRSGTYGDRTESKAYGS
VIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYG
CEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYC
GRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQF
TTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQAS
SLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSK
HIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMV
TLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCG
DKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAE
GQPALAETSPTAPECPPPAE
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggactttccccagcacagccagcacgtcttggaacagctgaaccagcagcgacagctg
gggcttctctgtgactgcacctttgtggtggacggtgttcactttaaggctcataaagca
gtgctggcggcctgcagcgagtacttcaaaatgctctttgtggaccagaaggacgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacggcc
aagctgagcctgagccctgagaacgtggatgatgtgctggccgtggccaccttcctccaa
atgcaggacatcatcacagcctgccatgccctcaagtcacttgccgagccggctaccagc
cctgggggaaatgcagaggccttggccacagaaggaggggacaagacagctaaagaggag
aaggcggccaccagcatgctgagcaggctggagcaggcaggacgcagcgcacccacaggc
cccagcagggacctcaaggaggagcgtggcggtcaggcccagagcacagccagcggtgca
gagcagacagagaaagccgatgcgccccgggagccgccgcctgtggagctcaagccagac
cccactagtggcatggctgccgcagaagctgaggctgctttgtccgagagctcggagcaa
gaaatggaggtggagcccgcccggaaaggggaagaggagcaagaggagcaagaggaggag
ggcgcagggccagctgaggtcaaggaggagggtccccagctggagaacggagaggccccc
gaggagaacgagaacgaggagtcagcgggcacagactcggggcaggagctcggcgccgag
gcccggggcctgcgctcaggcacctacggtgatcgcacggagtccaaggcctacggctcc
gtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaacttcaagcgg
cacatccgcatccacacgggggagaagcccttctcgtgccgtgagtgcagcaaggccttt
tccgacccggcggcctgcaaggcccatgagaagacgcacagccctctgaagccctacggc
tgcgaggagtgcgggaagagctaccgcctcatcagcctgctcaacctgcacaagaagcgg
cactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcaccacctcgggc
aacctcaagcgccaccagctggtgcacagcggcgagaagccctaccagtgcgactactgc
gggcgctccttctccgaccccacttccaagatgcgccacctggagacccacgacacggac
aaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaacctgaaggcc
cacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtgggaagcagttc
accacctcagggaacctgaagcggcaccttcggatccacagcggggagaagccctatgtg
tgtatccactgccagcgacagtttgcagaccccggcgctctgcagcggcatgtccgcatt
cacacgggtgagaagccgtgccagtgtgtgatgtgcggtaaggccttcacccaggccagc
tccctcatcgcccacgtacgccagcacacgggggagaagccctacgtctgcgagcgctgc
ggcaagagatttgtccagtccagccagctggccaatcatattcgccaccacgacaacatc
cgtccacacaagtgcagcgtgtgcagcaaggccttcgtgaatgtgggggacctctccaag
cacatcatcatccacactggagagaagccttacctgtgtgataagtgcgggcgtggcttc
aaccgggtagacaacctgcgctcccacgtgaagacggtgcaccagggcaaggcaggcatc
aagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggatgacatggtc
acgctggccactgaggcactggcagcgacagccgtcactcagctcacagtggtgccggtg
ggagctgcagtgacagccgatgagacggaagtcctgaaggccgagatcagcaaagctgtg
aagcaagtgcaggaggaagaccccaacactcacatcctctatgcctgtgactcctgtggg
gacaagtttctggatgccaacagcctggctcagcacgtgcgaatccacacagcccaagca
ctggtcatgttccagacagacgcggacttctaccagcagtatgggccaggtggcacgtgg
cctgccgggcaggtgctgcaggctggggagctggtcttccgccctcgggatggggctgag
ggccagcccgcactggcagagacctcccctacagctcctgaatgtccgccgcctgccgag
tga

DBGET integrated database retrieval system