KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668410
Entry
104668410         CDS       T03989                                 

Gene name
MYBPC3
Definition
(RefSeq) myosin-binding protein C, cardiac-type
  KO
K12568  myosin-binding protein C, cardiac-type
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104668410 (MYBPC3)
   05414 Dilated cardiomyopathy
    104668410 (MYBPC3)
SSDB
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 V-set THB C2-set_2 PKD_3 Herpes_gE
Other DBs
NCBI-GeneID: 104668410
NCBI-ProteinID: XP_010369414
LinkDB
Position
15
AA seq 1273 aa
MPEPGKKPVSAFSKKPRSVEVAAGSPVVFEVETERAGVKVRWQRGGSDIGASSKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVTEAEKAEPVLAPAPAPAEATGTPGEA
LAPAAELGESAPSPEGSSSAARNAPTSGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG
ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGGYRCE
VSTKDKFDCSNFNLTVHEAMGTGDLDLLSSFRRTSLAGGGRRISDSHEDAGILDFSSLLK
KSSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRHDEKK
STAFQKKLEPAYQVSKGHKIRLTVELADPDAEVRWLKNGQEIQMSGSKYIFESIGAKRTL
TISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEG
AQVKWLKDGVELTREETFKYRFKKDGRRHRLIINEATLEDTGHYALRTSGGQALAELIVQ
EKKLEVYQSIADLTVGAKDQAVFKCEVSDENVRGVWLKNGKELLPDSRIKVSHIGRVHKL
TIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVV
VAGNKLRLDVPISGDPAPTVIWQKAITQGSKSPARPAPDAPEDAGDSDEWVFDKKLLCET
EGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDRVNLTVKVIDVPDAPAAPKVS
NVGEDSCTVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV
YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGL
DGYSVEYCPEGCSEWVTALRGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEP
VTVQEILQRPRLQLPRHLRQTIQKKVREPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSV
RNSPTDTILFIRAARRAHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTEAWGLN
VALEWKPPQDDGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFS
QNMVGSSDTAATTKEPVFIPRPGITYVPPNYKALDFSEAPSFTQPLVNRSVIAGYTTMLC
CAVRGSPKPKISWFKNGLDLGGDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE
AQCECRLEVRVPQ
NT seq 3822 nt   +upstreamnt  +downstreamnt
atgcctgagccggggaagaagccagtctcagctttcagcaagaagccacggtcagtggaa
gtggccgcaggcagccctgtcgtgtttgaggtggagacagagcgggcgggagtgaaggtg
cgctggcagcgcggaggcagtgacatcggagccagcagcaagtatggcctggccacagag
ggcacacggcatacactgacagtgcgggaggtgggccctgctgaccaggggtcctacgca
gtcattgctggctcctccaaggtcaagttcgacctcaaggtcacagaggcagagaaggca
gagcctgtgctggcccctgcccctgcccctgctgaggccactggaacccctggagaagcc
ctggccccagccgctgagctgggagaaagtgccccaagtcctgaagggtcaagctcagca
gctcgcaacgcccctacctctggagcacctgatgaccccattggcctcttcgtgatgcgg
ccacaggatggcgaggtgactgtgggtggcagcatcaccttctcagcccgtgtagccggc
gccagcctcctgaagccgcctgtggtcaagtggttcaagggcaaatgggtggacctgagc
agcaaggtgggccagcacctgcagctgcatgacagctacgaccgtgccagcaaggtctat
ctgttcgagctgcacatcactgatgcccagcctgccttcactggcggctaccgctgtgag
gtgtccaccaaggacaaatttgactgctccaacttcaatctcactgtccatgaggccatg
ggcactggagacctggacctcctatcatccttccgccgcacgagcctggctggaggtggt
cggcggatcagtgacagccatgaggatgctgggattctggacttcagctcactgctgaag
aagagcagtttccggaccccaagggactcaaagctggaggcaccagcagaggaggacgtg
tgggagatcctacggcaggcacccccatccgagtacgagcgcatcgccttccagtacggc
gtcaccgacctgcgcggcatgctgaagaggctcaagggcatgaggcacgatgagaagaag
agcacagcctttcagaagaagctggagccggcctaccaggtgagcaaaggccacaagatc
cggctgaccgtggaactggccgaccctgacgctgaagtcagatggctcaagaatggccag
gagatccagatgagcggcagcaagtacatctttgagtccattggtgccaagcgtaccctg
accatcagccagtgctcactggcagacgatgcagcctaccagtgcgtggtgggtggcgag
aagtgcagcacggagctctttgtcaaagagccccccgtgctcatcacgcgccccttggag
gaccagctggtgatggtgggacagcgggtggagtttgagtgtgaagtatcggaggagggg
gcgcaagtcaaatggctgaaggacggggtggagctgacccgggaggagaccttcaaatat
cggttcaagaaggacgggcggagacaccgcctgatcatcaacgaggccacgctggaggac
acagggcactacgcgctgcgcaccagcgggggccaggcgctggctgagctcatcgtgcag
gaaaagaagctggaggtgtaccagagcatcgcagacctgacggtgggcgcgaaggaccag
gcagtgttcaagtgtgaagtctcagatgagaacgtgcggggcgtgtggctgaagaacggg
aaggagctgttgcccgacagccgcataaaggtgtcccacattgggcgggtccacaaactg
accattgacgacgtcacacctgccgacgaggctgactacagctttgtgcccgagggcttc
gcctgcaacctgtcagccaagctccacttcatggaggtcaagattgacttcgtacccagg
caggaacctcccaagatccacctggactgcccgggccgcataccagacaccattgttgtt
gtagctggaaataagctacgtctggacgtccctatctctggggaccctgctcccaccgtg
atctggcagaaggctatcacacaggggagtaagtccccagccagaccagccccagatgcc
ccagaggatgcaggtgacagcgacgagtgggtgtttgacaagaagctgctgtgtgagact
gagggccgcgtccgcgtggagaccaccaaggaccgcagcatcttcacggtcgagggggca
gagaaggaagatgagggcgtctacacggtcacggtgaagaaccctgtgggcgaggaccgg
gtcaacctcacagtcaaggtcatcgacgtgccagacgcacctgcggcccccaaggtcagc
aacgtgggagaggactcctgcaccgtacagtgggagccgcctgcctacgacggcgggcag
ccagtcctgggctacatcctggagcgcaagaaaaagaagagctaccggtggatgcggctg
aatttcgacctgattcaggagctgagccacgaagcgcggcgcatgatcgagggcgtggtg
tacgagatgcgcgtctacgccgtcaacgccatcggcatgtccaggcccagccctgcctcc
cagcccttcatgccgattggtccccccagcgaacccacccacctggcagtagaggacgtt
tctgacaccacggtctccctcaagtggcggcccccagagcgcgtgggagcaggaggcctg
gatggctacagcgtggagtactgcccagagggctgctcagagtgggtgactgccctgcgg
gggctgacagaacacacgtcgatactggtgaaggacctgcccacgggggcccggctgctc
ttccgagtgcgtgcacacaatatggcagggcctggagcccctgttaccaccacggagccg
gtgacagtgcaggagatcctgcaacggccacggctccagctgcccaggcacctgcgtcag
accattcagaagaaggtcagggagcctgtgaacctcctcatccctttccagggcaagccc
cggcctcaggtgacctggaccaaagaggggcagcccctggcaggcgaggaggtgagcgtc
cgcaacagccccacagacaccatcctgttcatccgggccgctcgccgcgcgcattcaggc
acttaccaggtgacagtgcgcattgagaacatggaggacaaggccaccctggtgctgcag
gttgtcgacaagccaagtcctccccaggatctccgggtcactgaggcctggggtcttaat
gtggctctggagtggaagccaccccaggatgatggcaacacggagctctgggggtacaca
gtgcagaaggccgacaagaagaccatggagtggttcaccgtcttggagcattaccgccgc
acccactgcgtggtgccagagctcatcattggcaatggctactacttccgtgtcttcagc
cagaatatggttggttccagtgacacagcagccaccaccaaggagcccgtctttatcccc
agaccaggcatcacctatgtgccacccaattataaggccctggacttctctgaggcccca
agcttcacccagcccctggtgaaccgctcggtcatcgcaggctacaccactatgctctgc
tgtgctgtccggggtagccccaagcccaagatttcctggttcaagaatggcttggacctg
ggaggagatgcccgcttccgcatgttcagcaagcagggagtgttgactctggagattaga
aagccctgcccctttgatggaggcatctatgtctgcagggccaccaacttacagggcgag
gcacagtgcgagtgccgcctggaggtgcgagtgcctcagtga

DBGET integrated database retrieval system