KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671818
Entry
104671818         CDS       T03989                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase isoform X1
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104671818 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104671818 (FHIT)
   05223 Non-small cell lung cancer
    104671818 (FHIT)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     104671818 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C LPD29
Other DBs
NCBI-GeneID: 104671818
NCBI-ProteinID: XP_010373745
UniProt: A0A2K6N901
LinkDB
Position
1
AA seq 149 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
VTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKTGDFHRNDSIYEKLQKH
DKEEEDSPVSWRSEEEMAEEAAALRVYFQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtcgttcagatttggccaacatctcatcaagccctctgtggtgtttctcaaaacagaa
ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtcctcgtgtgcccg
ctgcggccagtggagcgcttccacgacctgcgtcctgatgaagtggctgatttgtttcag
gtgacccagagagtcgggacagtggtggaaaaacatttccacgggacctctctcaccttt
tccatgcaggatggccccgaagctggacagactgtgaagcacgttcacgtccatgttctt
cccaggaagactggagactttcacaggaatgacagcatctatgagaagctccagaaacat
gacaaggaagaggaggactccccagtctcttggagatcagaggaggaaatggcagaagaa
gctgcagctctgcgggtctactttcagtga

DBGET integrated database retrieval system