KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674556Help
Entry
104674556         CDS       T03989                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00010  Glycolysis / Gluconeogenesis
rro00053  Ascorbate and aldarate metabolism
rro00071  Fatty acid degradation
rro00280  Valine, leucine and isoleucine degradation
rro00310  Lysine degradation
rro00330  Arginine and proline metabolism
rro00340  Histidine metabolism
rro00380  Tryptophan metabolism
rro00410  beta-Alanine metabolism
rro00561  Glycerolipid metabolism
rro00620  Pyruvate metabolism
rro01100  Metabolic pathways
Module
rro_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104674556 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    104674556 (ALDH2)
   00620 Pyruvate metabolism
    104674556 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104674556 (ALDH2)
   00561 Glycerolipid metabolism
    104674556 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104674556 (ALDH2)
   00310 Lysine degradation
    104674556 (ALDH2)
   00330 Arginine and proline metabolism
    104674556 (ALDH2)
   00340 Histidine metabolism
    104674556 (ALDH2)
   00380 Tryptophan metabolism
    104674556 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104674556 (ALDH2)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104674556 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 104674556
NCBI-ProteinID: XP_010377208
UniProt: A0A2K6NRB9
LinkDB All DBs
Position
Un
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGLRLLSAAATQAVPAPNQQPEVFCNKIFINNEWHNAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTITIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgctgccgcccgcttcgggccccgcctgggcctccgcctcttgtcagctgcc
gccacccaggccgtgcccgcccccaaccagcagcccgaggtcttctgcaacaagatcttc
ataaacaatgaatggcacaatgccgtcagcaggaaaacattccccacggtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggctgccttccaactgggctcaccttggcgtcgcatggacgcatcacac
aggggccggctgctgaaccgcctggctgatctgatcgagcgggaccggacctacctggcg
gccttggagactctggacaatggcaaaccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
attcccattgacggagacttcttcagctacacccgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacgcccctcactgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggtcaacatcgttcctgga
tttggccccacggccggggccgccatcgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagattggccgcctcattcaggttgctgccgggagcagcaatctcaag
agagtgaccctggagctaggggggaagagccccaacatcatcatgtcagatgccgacatg
gactgggccgtggagcaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gctggctcccggaccttcgtgcaggaggacatctatgacgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacactgggaaacaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
accgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaagttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcaccgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggcggctacaagatgtcgggcagtggccgggagctgggcgagtacggcctgcag
gcatacactgaagtgaaaactatcacaatcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system