KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674820
Entry
104674820         CDS       T03989                                 

Gene name
LBX2
Definition
(RefSeq) transcription factor LBX2 isoform X1
  KO
K09353  homeobox protein LBX
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104674820 (LBX2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104674820 (LBX2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104674820
NCBI-ProteinID: XP_010377555
LinkDB
Position
17
AA seq 323 aa
MGPFPTPTRTPGSLGSPSVLGRENHAQGPLWLRATENAPGRGAALRSQRRGGGRTTPGRC
TPGRSRPCCASGTRRLFSPGGQTLPLPTFLNPAISKTHAQRRQHQDLLQPLAQRSTGPSV
SLANHSQGLMGKRTSLEVIIAELGGEKCRGGRRSFPPLAASPPAHPGGWRWARRDLCKTT
SRAQNNSQACRAPRRAAADALGPGPAGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSER
DGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPDGAPHPS
LCLGAAGPDSRPQLSDEEIQVDD
NT seq 972 nt   +upstreamnt  +downstreamnt
atgggtccattccccactcccacccggaccccggggtcactcgggtctccgtctgtgcta
gggagggagaatcacgcccagggtcctctctggcttcgagcgactgagaacgcgcccgga
cgcggcgcggcgctccggagtcaaaggagaggcggcggcaggaccaccccagggcgctgc
acccccggacgctctcggccgtgctgcgcttccgggacaaggcgtctgttctcccctggg
ggccaaaccttgcctctgcccaccttcctcaaccccgccatttccaagactcacgcgcag
aggcgacagcaccaggatttgctccagcctttggcacagaggagcacgggtccctctgtc
agcctggccaatcattcccaaggcttgatgggaaaaaggacttccctagaagtgattatt
gcggagttgggtggagaaaaatgtcggggagggcgtcggagtttcccaccgctggctgct
tccccacccgcacacccgggagggtggcggtgggcgcgcagagatctttgcaaaacaacg
tccagggcgcaaaacaactcacaggcctgccgcgccccaaggcgggcagccgcggatgcg
ctgggccctggccctgccggccgcaaacggcgcaagtcacgcacggcgttcaccgcgcaa
caggtgctggagctggagcggcgcttcgtcttccagaagtacctggctccgtccgagcga
gacgggctagctacacgactaggcctggccaacgcgcaagtggtcacttggttccagaac
cgacgagccaagctcaagcgcgacgtggaggagatgcgcgccgacgtcgcctcgctacgc
gcgctgtcccccgaggtcctgtgcagcttagcactgcccgacggcgctccacatcctagc
ctctgcctcggagccgccggccctgactcccggccccaactgtcagacgaagagatacag
gtggacgattga

DBGET integrated database retrieval system