KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677168
Entry
104677168         CDS       T03989                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04340  Hedgehog signaling pathway
rro04371  Apelin signaling pathway
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04530  Tight junction
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104677168 (CCND1)
   04340 Hedgehog signaling pathway
    104677168 (CCND1)
   04390 Hippo signaling pathway
    104677168 (CCND1)
   04371 Apelin signaling pathway
    104677168 (CCND1)
   04630 JAK-STAT signaling pathway
    104677168 (CCND1)
   04068 FoxO signaling pathway
    104677168 (CCND1)
   04151 PI3K-Akt signaling pathway
    104677168 (CCND1)
   04152 AMPK signaling pathway
    104677168 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104677168 (CCND1)
   04115 p53 signaling pathway
    104677168 (CCND1)
   04218 Cellular senescence
    104677168 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104677168 (CCND1)
   04530 Tight junction
    104677168 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104677168 (CCND1)
   04921 Oxytocin signaling pathway
    104677168 (CCND1)
   04919 Thyroid hormone signaling pathway
    104677168 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677168 (CCND1)
   05206 MicroRNAs in cancer
    104677168 (CCND1)
   05205 Proteoglycans in cancer
    104677168 (CCND1)
   05203 Viral carcinogenesis
    104677168 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104677168 (CCND1)
   05212 Pancreatic cancer
    104677168 (CCND1)
   05225 Hepatocellular carcinoma
    104677168 (CCND1)
   05226 Gastric cancer
    104677168 (CCND1)
   05214 Glioma
    104677168 (CCND1)
   05216 Thyroid cancer
    104677168 (CCND1)
   05221 Acute myeloid leukemia
    104677168 (CCND1)
   05220 Chronic myeloid leukemia
    104677168 (CCND1)
   05218 Melanoma
    104677168 (CCND1)
   05219 Bladder cancer
    104677168 (CCND1)
   05215 Prostate cancer
    104677168 (CCND1)
   05213 Endometrial cancer
    104677168 (CCND1)
   05224 Breast cancer
    104677168 (CCND1)
   05222 Small cell lung cancer
    104677168 (CCND1)
   05223 Non-small cell lung cancer
    104677168 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104677168 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104677168 (CCND1)
   04934 Cushing syndrome
    104677168 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104677168 (CCND1)
   05162 Measles
    104677168 (CCND1)
   05160 Hepatitis C
    104677168 (CCND1)
   05163 Human cytomegalovirus infection
    104677168 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104677168 (CCND1)
   05169 Epstein-Barr virus infection
    104677168 (CCND1)
   05165 Human papillomavirus infection
    104677168 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104677168 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104677168
NCBI-ProteinID: XP_030773261
LinkDB
Position
15
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIQPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLGSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaatgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagccggtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccatccccctgaca
gccgagaagctgtgcatctacaccgacaactccatccagcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcatgatttc
attgaacacttcctttccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccaccc
tccatggtggcagcggggagcgtagtggccgcagtgcaaggcctgaacttggggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system