KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678844Help
Entry
104678844         CDS       T03989                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    104678844 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 104678844
NCBI-ProteinID: XP_010382531
UniProt: A0A2K6Q5N7
LinkDB All DBs
Position
13
AA seq 578 aa AA seqDB search
MAAAMPLALLVLLLLGPRGWCLAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITNYNQDNETLEVNPPP
TTTYQDIILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPAVPFLHAQRYVSG
YGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVVA
AKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctatgccgcttgctctgctcgtcctgctgctcctggggcccagaggctgg
tgccttgcagaacccccacgcgacagcctgcgggaggaacttgtcatcaccccactgcct
tccggggacgtagccgccacattccagttccgcacgcgctgggattcggagcttcagcgg
gaaggagtgtctcattacaggctctttcccaaagccctggggcagctgatctccaagtat
tctctacgggagctgcacctatcattcacacaaggcttttggaggacccgatactgggga
ccacccttcctgcaggccccatcaggtgcagagctctgggtctggttccaagacactgtc
actgatgtggataaatcttggaaggagctcagtaatgtcctctcagggatcttctgcgcc
tctctcaacttcatcgactccaccaacacggtcactcccactgcctccttcaaacccctg
ggtctggccaatgacactgaccactactttctgcgctatgctgtgctgccacgggaggtg
gtctgcactgaaaacctcaccccctggaagaagctcttgccctgtagttccaaggcaggc
ctctctgtgctgctgaaggcggatcgcttgttccacaccagctaccactcccaggcagtg
catatccgccctgtttgcagaaatgcacgctgtactagcatctcctgggagctgaggcag
accctgtcagttgtatttgacgccttcatcacggggcaggggaagaaagactggtccctc
ttccggatgttctcccgaaccctcacggagccctgccccctggcttcagagagccgagtc
tatgtggacatcaccaactacaaccaggacaacgagacattagaggtgaacccacccccg
accactacatatcaggacatcatcctaggcactcggaagacctatgccatctatgacttg
cttgacaccgccatgatcaacaactctcgaaacctcaacatccagctcaagtggaagaga
cccccagagaatgaggcccccgcagtgcccttcctgcatgcccagcggtacgtgagcggc
tatgggctgcagaagggggagctgagcacactgctgtacaacacccacccataccgggcc
ttcccagtgctgctgctggacaccgtaccctggtatctgcggctgtatgtgcacaccctc
accatcacctccaagggcaaggagaacaaaccaagttacatccactaccagcctgcccag
gaccggctgcaaccccacctcctggagatgctgattcagctgccggccaactcagtcacc
aaggtttccatccagtttgagcgggcgctgctgaagtggaccgaatacaccccagatcct
aaccatggcttctatgtcagcccatctgtcctcagcgcccttgtgcccagcgtggtagca
gccaagccagtggactgggaagagagtcccctcttcaacagcctgttcccggtctccgat
ggctctaactactttgtgcggctctacacggagccgctgctggtgaacctgccgacacca
gacttcagcatgccctacaacgtgatctgcctcacgtgtactgtggtggctgtgtgctat
ggctccttctacaatctcctgacccgaaccttccacatcgaggagccccgcacaggtggc
ctggccaagcggctggccaacctcatccggcgtgcccgaggtgtccccccactctga

DBGET integrated database retrieval system