KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679189
Entry
104679189         CDS       T03989                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2 isoform X1
  KO
K04962  ryanodine receptor 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04371  Apelin signaling pathway
rro04713  Circadian entrainment
rro04911  Insulin secretion
rro04921  Oxytocin signaling pathway
rro04972  Pancreatic secretion
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104679189 (RYR2)
   04020 Calcium signaling pathway
    104679189 (RYR2)
   04024 cAMP signaling pathway
    104679189 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104679189 (RYR2)
   04921 Oxytocin signaling pathway
    104679189 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104679189 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    104679189 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    104679189 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104679189 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    104679189 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    104679189 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104679189 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104679189 (RYR2)
   05414 Dilated cardiomyopathy
    104679189 (RYR2)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Ryanodine receptor
   104679189 (RYR2)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   104679189 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 104679189
NCBI-ProteinID: XP_030791948
LinkDB
Position
8
AA seq 4975 aa
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPACSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSHTDIMFYRLSMPIECAEVFSKTVAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQ
CLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHV
DEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFP
DENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKAKTIQMLTEAVK
EGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEE
RDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRH
RIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFK
DDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLK
KKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVR
ALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPN
LMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSY
LLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQML
VSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGG
NGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYAALIDLLG
RCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNAVEPDMSAGF
CPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYL
CTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQL
RPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHL
SRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN
FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPY
KLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHG
YSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAK
EKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYI
LEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKE
KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAF
LDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGED
LILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNI
YSIYNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILP
MLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLA
VFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFT
TLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFV
VQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNI
CAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDD
TSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVV
ACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKR
VDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQ
RSKEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNST
VQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQD
DEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYY
SGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFA
HMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEM
ILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAET
DENETLDYEEFVKRFHEPAKDISFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPF
LGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNF
CEDTIFEMQLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVKSALFALRYNI
LTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSL
LLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEE
SDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEK
EETKSEPEKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLL
NYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSH
RIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEF
DGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGM
DKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLG
HYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKF
YNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFF
FVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQE
HNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 14928 nt   +upstreamnt  +downstreamnt
atggccgatgggggcgagggcgaagacgagatccagttcctgcgaactgatgatgaagtg
gttctgcagtgcaccgcaaccatccacaaagaacaacagaaactatgcttggcagcagaa
ggatttggcaacagactttgtttcttggagtccacttccaattccaagaatgtaccccca
gacctctccatctgcacctttgtgctggagcagtctctctctgtccgggccctgcaggag
atgctggctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattc
atgatgaagactgctcaaggtggtggtcatcgaacactcctctatggacatgccatattg
ctgcgccattcctacagtggcatgtatctgtgctgcctgtccacctcccggtcttcaact
gataagctggcttttgatgttggcttgcaagaggacaccacaggggaggcttgttggtgg
accatacaccctgcctctaagcagcgatcagaaggagaaaaagtacgagttggagatgac
ctcatcttagttagcgtgtcctctgaaaggtacttgcacttgtcttacggcaatggcagc
ttacatgtggatgccgctttccagcagactctctggagcgtggccccaatcagctcagga
agtgaggcagcccaagggtatctcattggtggtgatgtcctcaggttgctgcatggacac
atggacgagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaactgtt
cattatgaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacacta
agagttgcgtggagtggaagccacataagatggggccagccattccgactacgccatgtc
acaacaggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagag
aaagctgatgtaaaatcaacagcatttaccttccggtcttccaaggaaaaattggatgta
ggggtgagaaaagaagttgacggcatgggaacatctgaaataaaatacggtgactcagta
tgctatatacaacacgtggacacgggactatggcttacttaccagtctgtggatgtgaaa
tccgtgagaatgggatctatacaacgtaaggctattatgcaccatgaaggccacatggat
gatggcataagtttatcgagatcccagcatgaagaatcacgcacagcacgagttatccgg
agcacagtcttccttttcaatagatttataaggggccttgatgctctcagcaagaaagcg
aaggcttccaccgtcgatttgcctatagaatccgtaagtctaagtctgcaggatctcatt
ggctactttcacccccccgatgagcatttagaacatgaagacaaacagaacagactacga
gccctgaagaatcggcaaaatctcttccaggaagagggaatgatcaacctcgtgctcgag
tgcatagaccgattgcacgtctacagcagtgcagcacactttgctgatgttgctgggcga
gaagcaggggaatcttggaaatccattctgaattctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgtgctcagttttctggctcccttgactggttgatcagc
agattggaaagactggaagcttcttcaggcattctggaagttttacactgtgttttagta
gaaagtccagaagctctaaatattattaaagaaggacatattaaatccattatctcactt
ttagacaagcatggaagaaatcacaaggtcctggacgtgttgtgctcactctgtgtttgc
catggggttgcagtccggtctaaccagcatctcatctgtgacaatctcttaccgggaaga
gatttgttattgcagacacgtcttgtgaaccacgtcagcagcatgagacccaatattttt
ctgggcgtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggac
cacacagagccctttgtgacagctgaagcaactcacctgcgagtgggctgggcttccact
gaagggtattctccctaccctggagggggcgaagagtggggtggaaatggtgttggagat
gatctcttctcctatggatttgatggccttcatctctggtcaggttgtattgctcgtact
gtaagctcaccaaaccaacatctgttaagaactgatgatgtcatcagttgctgtttagat
ctaagtgccccaagcatctcgttccgaattaatggacaacctgttcaaggaatgtttgag
aatttcaacatcgatggcctcttctttccagtcgttagtttctctgcgggaataaaagta
cgctttctgcttggggggcgacatggagaattcaaatttcttcctccacctgggtacgct
ccttgttatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtac
aagcaagaaagaacttacacacgcgacctgctgggccccacagtttccctgacacaagct
gccttcacaccgatccctgtggataccagccagattgtgttgcctcctcatctagaaaga
ataagagaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagctt
ggctggcagtatggaccggttagagatgacaacaagagacaacacccatgcctggtggag
ttctccaagctgcctgaacaggagcgcaattacaacttacaaatgtcgcttgagaccctg
aagactttgttggcattagggtgtcatgtgggtatatcagatgaacatgctgaagacaag
gtgaaaaaaatgaagctacccaagaattaccagctgacaagtggatacaagcctgcccct
atggacctaagctttatcaaactcaccccgtctcaagaagcaatggtggacaagttagca
gaaaatgcgcacaatgtgtgggcgcgggatcgaatccggcagggctggacttacggcatc
cagcaggacgtaaagaacagaagaaatcctcgccttgttccctacactcttctggatgac
cgaaccaagaaatccaacaaggacagcctccgcgaggctgtgcgcacgctgctggggtat
ggttacaacttggaagcaccagatcaagatcatgcagccagagccgaagtgtgcagtggc
accggggaaaggttccgaatcttccgtgctgagaagacttacgcagtgaaggcgggacgg
tggtattttgaatttgagacagtcactgctggagacatgagagttggttggagtcggcct
ggttgtcaaccggatcaggagcttggctcggatgaacgtgcctttgcctttgatggcttc
aaggcccagcggtggcatcagggcaacgaacactatgggcgctcttggcaagcaggcgat
gtcgtgggctgtatggttgacatgaacgaacacactatgatgttcacactgaatggtgaa
atccttcttgatgattcaggttcagaactggctttcaaggactttgatgttggcgatgga
ttcatacctgcgtgtagccttggagtggctcaagtgggcaggatgaactttggaaaggat
gtcagcaccttgaaatacttcaccatctgtggcttacaagagggctatgaaccatttgcc
gttaatacaaatagggatattaccatgtggctgagcaagaggcttcctcagtttctccaa
gttccatcaaaccatgaacatatagaggtgaccagaatagacggcaccatagacagttcc
ccatgtttaaaggtcactcagaagtcttttggttctcagaacagccacactgatatcatg
ttctatcgcctgagcatgccgatcgagtgcgcggaggtcttctccaagactgtggctgga
gggctccctggggctggcctttttgggcccaagaatgatttggaagattatgatgctgat
tctgactttgaggttctgatgaagacagctcatggccatctcgtgcccgatcgtgttgac
aaagacaaagaagctaccaaaccagagtttaataaccacaaagattatgcccaggaaaag
ccctctcgtctgaaacaaagatttttgcttagaagaacaaagccagattacagcacaagc
cattctgcaagactcactgaagatgtccttgctgatgatcgggatgactatgatttcttg
atgcaaacgtccacgtactattactcagtgagaatctttcctggacaagaacctgctaat
gtctgggtgggctggattacatcggatttccatcagtatgacacaggctttgacttggac
agagttcgcacagtaacagttactctaggagatgaaaaaggaaaagtgcatgaaagcatc
aaacgcagcaactgctatatggtatgtgcgggtgagagcatgagccccgggcaaggacgc
aacaataatggactggagatcggctgtgtggtggatgctgccagcgggctgctcacgttc
attgccaatggcaaggaactgagcacatactatcaggtggagccgagtacaaaattattt
cctgcggtttttgcacaagctacaagtcccaatgttttccagtttgagttgggaagaata
aagaatgtgatgcctctctcggcgggattattcaagagtgagcacaagaaccccgtgccg
cagtgccccccgcgcctccacgtgcagttcctgtcacacgtcctgtggagcagaatgccc
aaccagtttttgaaggtagatgtgtctcgaataagtgaacgccaaggctggttggtgcag
tgtttggatcctctgcagttcatgtctcttcatatccctgaggaaaacagatctgttgac
atcttagagttgacagagcaggaggagttgctgaaatttcactatcacactctgcggctc
tactcagctgtctgtgctcttgggaaccaccgggtggcccacgccctgtgcagccacgtg
gatgaacctcagctcctctacgccattgagaacaagtacatgcctggtttgctgcgtgct
ggctactatgacctgctgatcgacatccacctgagctcctatgccactgccaggctcatg
atgaacaacgagtacattgtccccatgacggaggagacgaagagcatcaccctgttccct
gatgagaacaaaaagcacggccttccagggatcggcctcagcacctctctcaggccacgg
atgcagttttcctcccccagttttgtaagcattagtaatgaatgttaccagtacagtcca
gagttcccactggacatcctcaaggccaagaccatacagatgctgacggaagctgttaaa
gagggcagtcttcatgcccgggacccagttggagggactactgaattcctctttgtgcct
ctcatcaagcttttctataccctgctaatcatgggcatcttccacaacgaggacttgaag
cacatcttgcagttgatcgagcccagtgtgtttaaagaagctgccactccagaggaggag
agggatacgctggagaaagagcttagtgtggatgatgcaaagctgcaaggagctggtgag
gaagaagccaaggggggcaagcggcccaaggaaggcctgctccaaatgaaactgccagag
ccagttaaattgcagatgtgcctactgcttcaatacctctgtgactgccaggtccggcac
cggatagaagccattgtagccttttcagatgattttgtagctaagctccaagacaatcaa
cgtttccggtacaacgaagttatgcaagccttaaacatgtcagctgcactcacagccagg
aaaacaaaggaatttagatcaccacctcaagaacagatcaatatgcttctcaattttaag
gatgacaaaagtgaatgtccatgtccagaagaaattcgtgaccaactattggatttccat
gaagatttgatgacgcattgtggaattgagctggatgaagatgggtctctggatggaaac
agtgatttaacaattagagggcgtctgctatccctggtagaaaaggtgacatacctgaag
aagaagcaagcagaaaaaccagttgagagtgactccaaaaagtcctccactctgcagcag
ctgatctctgagaccatggtccgatgggctcaggagtctgtcattgaagaccccgagctg
gtgagggccatgtttgtgttgctccatcggcagtatgatggcattgggggtcttgttcgg
gcgctgccaaagacctacacgataaatggtgtgtccgtggaggacaccatcaacctgctg
gcatcccttggtcagattcggtccctgctgagtgtgagaatgggcaaagaagaagagaag
cttatgattcgtggattaggggatattatgaataacaaggtgttttaccagcaccctaat
ctcatgagggcactggggatgcatgagactgtgatggaggtcatggtgaacgtccttgga
ggtggagagtccaaggaaatcacctttcccaagatggtggccaactgttgccgttttctc
tgttacttctgtcgtataagtaggcagaatcaaaaagctatgtttgatcatctcagttat
ttactggaaaacagcagtgttggtcttgcctccccagctatgagaggttcaacaccactg
gatgtggctgcagcttcggtgatggataataatgaactagcattagctctgcgtgagccg
gatctagaaaaggtagttcgttacttggctggttgtggactgcaaagttgccaaatgctg
gtgtctaagggttatccagacattgggtggaatccagttgaaggagagagatatcttgac
tttctcagatttgctgtcttctgcaatggggagagtgtggaggagaatgcaaatgtcgtg
gtgagattgctcattcggaggcctgagtgttttggtcctgctttgagaggagaaggtggg
aatgggcttcttgcagcaatggaagaagccatcaaaatcgccgaggatccctctcgagat
ggtccctcaccaaatagcggatccagtaaaacacttgatacagaggaggaggaagatgac
actatccacatggggaacgcaatcatgaccttctatgcagctttgattgacctcttggga
cgctgtgcaccagagatgcatttgattcatgctggtaagggagaagccatcagaattagg
tctattttgagatccctaattcccttgggagatttggtgggcgttatcagcatcgctttt
cagatgccaacaatagccaaagatgggaatgcggtggagcctgacatgtctgcggggttt
tgcccagatcacaaggcagccatggttttattccttgacagggtctatggaattgaggtt
caagacttcctcctccatcttcttgaggttggctttctgccagatctccgggcggctgct
tctttagatacggcggctttgagtgctacagacatggccttggccctcaatcggtacctt
tgcacagccgtcttgccgttgttaacaagatgtgctcctctctttgctggcacagagcac
catgcttctctcattgactcattacttcatactgtgtatagactttctaagggctgttca
cttaccaaagctcagcgggattctatagaagtttgtttactctctatttgtggacaactg
agaccttctatgatgcagcacttactcagaagattagtatttgatgtcccattattaaat
gaacatgcaaagatgcctcttaaactgctgacaaatcattatgaaagatgctggaaatat
tactgcctgcctggagggtggggaaactttggtgctgcctcagaagaagaacttcatttg
tcaagaaagttgttctggggcatttttgatgccctgtctcaaaagaaatatgagcaagag
cttttcaaactggcactgccttgcctgagtgcagttgcgggagctttgcctccagactac
atggagtcaaattatgtcagtatgatggaaaaacagtcatcaatggattctgaagggaac
tttaacccacaacctgttgatacctcaaatattacaattcctgagaagttggaatacttc
attaacaaatacgcagaacactcccatgacaaatggtcaatggacaagttggcaaatgga
tggatttatggagaaatatattcagactcttctaaggttcaaccattaatgaagccatat
aagctattgtctgaaaaggaaaaagaaatttatcgctggccaatcaaagaatctttaaaa
actatgctggcttggggctggagaattgaaagaactcgggagggagacagcatggccctt
tacaaccggactcgtcgtatttctcagacaagccaggtttctgtagatgctgcccatggt
tacagtccccgggccattgacatgagcaatgttaccctttctagagacctgcatgctatg
gcagaaatgatggctgaaaactaccataatatatgggcaaagaaaaagaaaatggagttg
gagtccaaaggaggaggtaaccaccctctgctggtgccctatgatacactgacagccaaa
gagaaagccaaggatagagaaaaagcacaggacatcctcaagttcttgcagatcaatgga
tatgctgtatctagaggatttaaggacctggaactggacacgccttctattgagaaacga
tttgcctacagtttcctccaacaactcattcgctatgtggatgaagcccatcagtatatc
ctggagtttgatggtggcagcagaggcaaaggagaacatttcccttatgaacaagaaatc
aagttctttgcaaaagtcgttcttcctttaattgatcagtatttcaaaaaccatcgttta
tacttcttatctgcagcaagcagacctctctgctctggaggacatgcttccaacaaagag
aaagaaatggtgactagcctattctgcaaacttggagttcttgtcaggcataggatttca
ctatttggcaacgacgcaacctcaattgtcaactgtcttcatattttgggtcagactttg
gatgcaaggacagtgatgaagactggcctggagagtgttaaaagtgcactcagagctttt
ctggacaatgccgcagaggatctggagaagaccatggaaaacctcaagcagggccagttc
actcacacccgaaaccagcccaaaggggttactcagattatcaattacaccacagtggcc
ctgcttccaatgctgtcatcattatttgaacatattggccagcatcagttcggagaagac
ctaatactggaagatgtccaggtgtcttgttatagaattctgactagcttgtatgctttg
ggaaccagcaagagtatttatgtggagaggcaacgttctgcattaggagaatgtcttgct
gcctttgctggtgcctttcctgtagcatttttggaaactcatctggacaaacataatatt
tactccatctacaataccaagtcttcacgagaaagagcagcgctcagtttgccaactaac
gtggaagatgtttgtccaaatataccgtctttggagaaactcatggaagaaatcgtggaa
ttagctgagtccggcattcgctacactcaaatgccacatgtcatggaagtcatactgccc
atgctttgcagctacatgtctcgctggtgggagcatggacctgagaacaatccagaacgg
gccgagatgtgctgcacagccctgaactcagagcacatgaacacacttctagggaacata
ttgaaaatcatatataataacttggggattgatgagggagcctggatgaagaggctagca
gtgttttcccagcctataataaataaagtgaaacctcagctcttgaaaactcatttcttg
ccgttaatggagaaactcaagaaaaaggcagccatggtggtgtctgaagaagaccacctg
aaagccgaggccaggggggacatgtcagaggctgaactcctcatcctagatgagttcacc
acgctggccagagatctctatgccttctaccctctcttgattagatttgtggactataac
agggcaaagtggctaaaggagcctaacccagaagcagaggagctcttccgcatggtggca
gaagtgtttatctactggtcgaaatcccataatttcaaaagggaagagcagaacttcgtt
gtacagaatgaaatcaacaatatgtctttccttattactgataccaagtccaagatgtcc
aaggcagctgtttctgatcaggaaaggaagaaaatgaagcgtaaaggagatcggtattcc
atgcagacctctctgattgtagcagctctgaagcgcttactgcccattgggttgaacatc
tgtgccccaggggaccaggagctcattgctctggccaaaaatcgatttagcctgaaagat
actgaggatgaagtacgagatataatccgcagcaatattcatttacaaggcaagttggag
gatcctgctattagatggcaaatggctctttacaaagacttaccaaacaggactgacgat
acctcagatccagagaagacggtagaaagagtattggatatagcaaatgtgctttttcat
cttgaacagaagtctaaacgtgtgggtcggagacattactgtctggtggaacatcctcag
agatctaaaaaggctgtatggcataaactactctctaagcagaggaaaagggctgttgta
gcctgcttccggatggcccctttatataatctgccaaggcatcgggctgtcaatctcttt
cttcagggatatgaaaagtcttggattgaaacagaagaacattactttgaagacaaactg
atagaagatttagcaaaacctggggctgaacctccagaagaagatgaaggcactaagaga
gttgatcctctgcatcagctgatccttctgtttagtcggacagctttaacagagaaatgc
aaactggaggaagattttttatatatggcctatgcagatattatggcaaagagttgtcat
gatgaggaagatgatgacggtgaagaggaagtgaagagttttgaagtcacaggatcccaa
cgcagcaaggaaaaagaaatggaaaagcaaaagcttctataccagcaagcccgactccac
gaccgtggtgcggctgagatggtgctgcagaccatcagtgccagcaaaggtgaaactgga
ccaatggtagcagctactttgaaacttggaattgctattttaaatggtgggaactccaca
gtacagcagaaaatgcttgactacctcaaggagaaaaaggatgtgggcttctttcagagc
ctggccggcctgatgcagtcatgtagtgtccttgacctaaatgcatttgagcgacaaaac
aaagctgaaggtcttgggatggtgacagaggaaggatcaggagaaaaggttctacaggac
gatgagttcacctgtgacctcttccgattcctgcagctactctgtgagggacacaactca
gattttcagaattatctgagaactcagactggcaataatacaactgtcaacataattatc
tccactgtagactacctactgagagttcaggaatcaattagtgacttttattggtattac
tctgggaaagatgttattgatgaacaaggacaacggaatttctccaaagctattcaagtg
gcaaaacaagtctttaacactcttactgagtatattcagggtccttgcactgggaatcaa
cagagtttggcacacagcaggctgtgggatgctgtagtcggctttcttcatgtatttgcc
catatgcagatgaagctgtcgcaggattccagtcaaattgagcttttgaaagaattaatg
gatctacagaaggatatggtggtcatgttgctgtccatgctagaaggtaatgttgttaac
ggaacgattggcaaacagatggtggatatgcttgtggaatcttccaacaatgtggagatg
attctcaaattttttgacatgttcttaaaactgaaagatttgacgtcgtctgatactttt
aaagaatatgaccctgatggcaagggagtcatttccaagagggacttccacaaagcgatg
gagagtcataagcactacacgcagtcagaaacggagtttcttttgtcttgtgcggagaca
gatgagaatgaaacccttgactatgaggagttcgtcaaacgcttccacgaacctgcaaag
gacatcagcttcaatgtcgccgtccttctgacaaacctctctgagcacatgcccaacgat
acccgacttcagactttcctagaattagcagagagtgtcctgaattatttccagcccttt
ctgggccgcatcgaaatcatgggaagcgccaaacgcatcgagagggtctattttgaaatc
agtgagtctagccgaacccagtgggagaagccccaggtcaaggagtccaaacgacagttc
atatttgatgtggtcaatgaaggaggagaaaaagagaagatggaactctttgtgaacttc
tgtgaggacaccatcttcgaaatgcagctggcggctcagatctcagagtcggatttgaac
gagaggtctgcgaataaggaagaaagtgagaaggagaggccggaagagcagggcccgaga
atggctttcttctccattctgacggtcaagtcggccctgtttgcgctcaggtacaatatc
ttgacccttatgcgaatgctcagtctgaagagcctgaagaagcagatgaaaaaagtcaaa
aagatgaccgtgaaggacatggtcacggccttcttttcatcctactggagtatttttatg
accctcttgcacttcgtggccagcgttttcagaggctttttccgcatcatttgcagcctg
ctgcttgggggaagcctcgtcgaaggtgctaaaaagatcaaagttgcagaactcttagcc
aacatgccagaccccactcaggatgaggttagaggagatggggaggagggagagaggaaa
cccctggaagccgccctgccctctgaggatctgaccgacttaaaggagctgacagaagaa
agtgaccttctttcagacatctttggcctggatctgaagagagaaggaggacagtacaaa
ctaatccctcataatccaaatgctggactcagtgacctcatgagcaacccagtccccatg
cctgaggtgcaagaaaaatttcaggaacagaaagcaaaagaagaagaaaaggaagaaaaa
gaagaaaccaaatctgaacctgaaaaagctgagggagaagatggagaaaaagaagagaaa
gccaaggaagacaagggcaaacaaaagttgaggcagcttcacacacacagatacggagaa
ccagaagtgcccgagtcagcgttctggaagaaaatcatagcataccaacagaaacttcta
aactattttgctcgcaacttttacaacatgagaatgttagccttatttgtcgcatttgct
atcaatttcatcttgctcttttataaggtctccacttcttctgtggttgaaggaaaggag
ctccccactagaagttcaagtgaaaatgccaaagtgaccagcctggacagcagctcccac
agaatcatcgcagttcactatgtactggaggagagcagcggctacatggagcccactttg
cgtatcttagctattctccacacagtcatttctttcttctgcatcattggatactactgc
ttgaaagtcccattggttatttttaagcgagaaaaggaagtagcacggaaattggaattt
gatgggctttatattacagaacagccttcagaagatgatattaaaggccagtgggataga
ctcgtaatcaacacacagtcatttcccaacaactactgggacaaatttgttaaaagaaag
gtaatggataaatacggagagttctatggccgagacagaattagtgaattacttggcatg
gacaaggcagctctggacttcagtgatgccagagaaaagaagaagccaaagaaagacagc
tccttatcagctgtactgaactctattgatgtgaagtatcagatgtggaaactaggagtc
gttttcactgacaactccttcctctacctagcctggtatatgactatgtctgttcttgga
cactataacaactttttttttgctgctcaccttctcgacattgctatgggattcaagaca
ttaagaaccatcttgtcctcagtaactcacaatggcaaacagctcgtattaaccgttggc
ttgttagctgttgttgtatacctgtacactgtggtggcattcaattttttccgaaaattc
tacaataaaagtgaagatggtgatacaccagatatgaaatgtgatgatatgctaacatgc
tatatgttccacatgtatgttggagttcgtgctggaggagggatcggggatgaaatcgaa
gacccagcaggagatgaatatgagatctatcgaatcatctttgacatcactttcttcttc
tttgttattgtcattctcttggccataatacaaggtctaattatcgatgcttttggagaa
ctaagagaccaacaggaacaagtcaaagaagacatggagaccaaatgcttcatctgtggg
ataggcaatgattacttcgacacagtgccacatggctttgaaacccacactttacaggag
cacaacttggctaattacttgttttttctgatgtatcttataaacaaagatgaaacagaa
cacacaggacaggaatcttatgtctggaagatgtatcaagaaaggtgttgggaatttttc
ccagcaggggattgtttccggaaacagtatgaagaccagctaaattga

DBGET integrated database retrieval system