KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679650
Entry
104679650         CDS       T03989                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro03013  RNA transport
rro04012  ErbB signaling pathway
rro04066  HIF-1 signaling pathway
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04218  Cellular senescence
rro04910  Insulin signaling pathway
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05168  Herpes simplex virus 1 infection
rro05221  Acute myeloid leukemia
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104679650 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104679650 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    104679650 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    104679650 (EIF4EBP1)
   04152 AMPK signaling pathway
    104679650 (EIF4EBP1)
   04150 mTOR signaling pathway
    104679650 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104679650 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104679650 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    104679650 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    104679650 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104679650 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104679650 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    104679650 (EIF4EBP1)
   05165 Human papillomavirus infection
    104679650 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104679650 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104679650 (EIF4EBP1)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     104679650 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 104679650
NCBI-ProteinID: XP_010383599
UniProt: A0A2K6RWW4
LinkDB
Position
9
AA seq 118 aa
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPKDLPAIPGVTSPSSDEPPPEASQSHLRNSPEDKRAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccaagtcgggccatccccgccactcgccgg
gtggtgctcggcgacggcgtgcagctccctcccggggactacagcacgacccccggcggc
acactcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcctgatg
gagtgtcggaactcacctgtgaccaaaacacccccgaaggatctgcctgccattcccggg
gtcaccagcccttccagtgatgagccccccccggaagccagccagagccacctgcgtaat
agcccagaagataagcgggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system