KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682093
Entry
104682093         CDS       T03989                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04152  AMPK signaling pathway
rro04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104682093 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104682093 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682093 (EEF2K)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     104682093 (EEF2K)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   104682093 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1
Other DBs
NCBI-GeneID: 104682093
NCBI-ProteinID: XP_010386901
LinkDB
Position
20
AA seq 725 aa
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDNEEGYFICPITDEPRSNQNVNSKVNKYY
SNLTKSERYGSSGSPANSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSTFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILMARAFDTGQNLSPDRCRDWLEALHWYKTALEMTDCDEGGEYDGMQ
DEPRYTMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggtcagtccccccga
gctggccatgatggtgattctgatggggacagcgacaatgaggaaggttacttcatctgc
cccatcaccgatgagccaaggtcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatggatccagcgggtccccagcaaactctttccac
ttcaaggaagcctggaagcacgcaatcgagaaagccaagcacatgcccgacccctgggct
gagttccacctagaagacattgccaccgaacgtgctactcgacacaggtacaacgctgtc
accggggaatggctggatgatgaagttctgatcaagatggcgtctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaccttcctgcacgcccagcag
tggaagggagcctccaactacgtggcgaagcgctacatagagcccgtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggagaagagtataaccgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgaaggacaga
ccaggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaat
tccaactctggctttgtccgtgatgacaacatccgcctgacgccgcaggccttcagtcac
ttcacgtttgagcgttccggccatcagctgatagtggtggacatccaaggagttggggat
ctctacactgacccacagatccacacagagacaggcactgactttggagacggcaaccta
ggtgtccgtgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcaccccgggagagggacgcggtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagatgagaacatgagcgatgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccaccttcattggccagtgttcagtgacctcgataac
atggcatccagagaccatgatcatctagacaaccaccgggactctgagaatagtggggac
agcggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcaaacggtaaccggaagtatgagtccgacgaagacagcctgggcagctctggacgg
gtctgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggagaggagtgggaccgggagtcggctgtcttccacctggagcacgcggccgac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagctgccccatcac
atcctagctgacgtctctctgaaggagacagaagagaacaaaaccaaaggatttgattat
ttactgaaggccgcagaagctggcgacaggcagtccatgatcctaatggcgcgagctttt
gacacaggccagaacctcagcccagacaggtgccgagactggctggaggccctgcactgg
tacaaaactgccctggagatgacggactgtgatgagggtggtgagtacgacggaatgcag
gacgagccccggtacacgatgctggccagggaggccgagatgctgttcacaggaggctat
gggctggagaaggacccgcagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccgactggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system